श्रेणी ओ पेट अंदर के घरेलू उपाय

हार्ट अटैक की गोली

एकबैलेंस्टडाइटमेंसभीजरूरीप्रोटीन,कार्बोहाइड्रेट,फैटऔरविटामिन्सहोतेहैं. 13॥ यहप्रायःएकमसालेकेतौरपरप्रयुक्तहोतीहै।दूधमेंमिलाकरपिनेंसेयहजमेहुएखूनकोपतलाकरतीहैऔरदर्दसेमुक्तिखिलातीहै।यहएककीटाणुनाशकभीहै।इसमेंएंटीसेप्टिक,एंटीबायोटिकऔरदर्दनिवारकतत्वपाएगएहैं।यहसूजनकोकमकरनेमेंसहायकहोतेहैं।घावपरहल्दीकालेपलगानेसेवहठीकहोजाताहै।हल्दी-चुनेकेलेपसेहड्डीकादर्दबहुतजलतीनिकलताहै।चोटलगनेपरदूधमेंहल्दीडालकरपीनेसेदर्दमेंराहतमिलतीहै।एकचम्मचहल्दीमेंआधाचम्मचकालागर्मपानीकेसाथफाँखनेसेपेटदर्दवगैसमेंराहतमिलतीहै।इसकाप्रयोगचन्दनऔरनीबूकेसाथएकसौंदर्यवर्ध्रककेरूपमेंभीकियाजाताहै कालीमिर्चकोसुईसेछेदकरदीयेकीलौसेजलाएं।जबधुँआउठेतोइसधुएंकोनाकसेअन्दरखीचलें।इसप्रयोगसेसिरदर्दठीकहोजाताहै।हिचकीचलनाभीबन्दहोजातीहै 8).

आगे की

छाती में जकड़न का इलाज

जंगलसेअश्वगंधालानेकेलिएआपकोइसकीपहचानहोनाआवश्यकहै.

आगे की

बीपी लो होने के बाद क्या खाना चाहिए

दरअसल,ज्यादातरसमयतोवोएपेटाइटमीटरपरदर्जहीनहींहोते. इसलिएसुबहउठकरऔरखानेसेकुछसमयपहलेपानीजरुरपियें.

आगे की

रुका हुआ पीरियड लाने की दवा

5se6dintakaappahlewalasebkasirkahiistemalkarsaktehaiuskebaadbadalle! 298,एएनअकरा,घाना पोस्टऑफिसबॉक्स3162,दुबईसरकाररियलएस्टेटबिल्डिंग,दूसरीमंज़िल,अलीबिनअबीतालिबस्ट्रीट,बरदुबई,यूएई पोस्टऑफिसबॉक्स.

आगे की

सबसे लंबी कोशिका कौन सी है

इसकेअलावाऐसाभीकहाजाताहैकिजोकपलअपनीशादीसेखुशहोतेहै,संतुष्टहोतेहै,औरसुरक्षितमहसूसकरतेहैंउनमेंवज़नबढ़नेकीसंभावनाकाफीज्यादाबढ़जातीहै,क्योंकिशादीकेबादउनपरकिसीऔरकोआकर्षितकरनेकादबावनहींहोताहै.

आगे की

मेधा वटी के फायदे पतंजलि

)कियाजायेगा हमारेदेशमेंप्रधानमंत्रीनरेंद्रमोदीनेट्वीटकरतेहुएकहाहैकिइसयोजनाकेअंतर्गतअबतक1करोड़सेअधिकलाभार्थियोंकोलाभपहुंचायागयाहैऔरइसयोजनाकासबसेबड़ालाभसुवाह्यताहैक्योंकिलाभार्थीनकेवलजहांवेपंजीकृतहैं,बल्किभारतकेअन्यहिस्सोंमेंभीइसयोजनाकेतहतआवेदनकरकेउच्चगुणवत्ताऔरसस्तीचिकित्सादेखभालप्राप्तकरसकतेहैं।अगरआपइसयोजनाकेलाभसेवंचितहैतोजल्दसेजल्दइसयोजनाकेतहतआवेदनकरेऔरकेंद्रसरकारद्वारा5लाखरूपयेतकस्वास्थ्यबीमाप्राप्तकरेऔरअपनाइलाजकरवाए| केअंतर्गतकेंद्रसरकारद्वारादेशकेगरीबपरिवारोंकोसालाना5लाखरूपयेकेस्वास्थ्यबीमाकीसहायता(Providinghealthinsuranceassistanceof5lakhrupeesannuallytothepoorfamiliesofthecountry)प्रदानकररहीहै।इसस्वास्थ्यबीमाकीसहायताकेदेशकेलोगअपनीबीमारियोंकाइलाजसूचीबद्धअस्पतालोंमेंनिशुल्ककरवासकतेहै।पीएमआयुष्मानभारतयोजनाकेतहत10करोड़लाभार्थियोंकोशामिलकियाजाएगा।इनपरिवारोंकोचयनितसरकारीऔरनिजीअस्पतालोंमेंमुफ्तस्वास्थ्यसेवाएंमिलेंगी।जोइच्छुकलाभार्थीइसयोजनाकेअंतर्गतपंजीकरणकरानाचाहतेहैतोवहनिकटजनसेवाकेंद्र(CSC)मेंजाकरपंजीकरणकरासकतेहै केअंतर्गतदेशकेलोगोकोइसयोजनाकेतहतआवेदनकरनेकेबादलाभार्थीसूचीमेंअपनेनामकीजांचकरनीहोगीउसकेबादहीलाभार्थियोंको5लाखरूपयेकास्वास्थयबीमाप्रदानकियाजायेगा कीहमारेदेशकेगृहमंत्रीश्रीअमितशाहकेद्वाराघोषणाकीगईहै।उन्होंनेइसअवसरपर7केंद्रीयसशक्तपुलिसबलोंकेकुछकर्मियोंकोआयुष्मानसीएपीएफस्वास्थ्यकार्डकावितरणकियाहै।आयुष्मानसीएपीएफयोजनाकेमाध्यमसेसीएपीएफ,आसामराइफलएवंराष्ट्रीयसुरक्षागार्डकेलगभग28लाखकर्मियोंकोलाभपहुंचायाजाएगा कीघोषणाकी।आजयहांएकसंवाददातासम्मेलनकोसंबोधितकरतेहुएश्रीमतीसीतारमणनेकहा,आजकिएगएविभिन्नउपायोंकाउद्देश्यनिर्धनतमलोगोंकेहाथोंमेंभोजनएवंपैसादेकरउनकीभरसकमददकरनाहै,ताकिउन्हेंआवश्यकआपूर्तियावस्तुओंकोखरीदनेऔरअपनीअनिवार्यजरूरतोंकोपूराकरनेमेंकठिनाइयोंकासामनानकरनापड़े। ए.

मानलीजिएयदिआपहररोज1500कैलोरीकासेवनकरतेहोतबयदिआपकोअपनावजनयामोटापाकोकमकरनाहैतबआपकोइसकोघटानाहोगा.

आगे की

रक्त को भानुमती का पिटारा क्यों कहा जाता है

10,000कदमचलनेसेहरदिनआपखुदइसकोमहसूसकरसकतेहैं.

आगे की

लिपिड प्रोफाइल टेस्ट क्या होता है

हमछोटेछोटेकदमउठाएंगेऔरअपनीइच्छाशक्तिकोप्रज्वलितकरेंगे!मैंएकमोटीइंसानथीजिसने5महीनेमें23किलोग्रामवजनकमकिया!यहहैमरीकहानी. Thecostcausedbythesellerstechniciansincustomerscountry(includingshuttletripticketbetweenChinaandtheBuyerscountry,inlandtraffic,medicalfees,lodging,dinnerandsoon)willbecoveredbybuyer किसीभीफिटनेसस्तरकेलिएबिल्कुलसहीहैचाहेआपशुरुआती,शौकिया,खिलाड़ीयाएथलीटहों.

आगे की

मेरा डायस्टोलिक ब्लड प्रेशर उच्च और सिस्टोलिक सामान्य क्यों है

आजहमआपकोइसपोस्टमेंबहुतबढ़ियाऔरमहत्वपूर्णजानकारीदेंगेयहजानकारीआपकेलिएजाननाबहुतहीजरूरीहै.

आगे की

पुरुष छाती में गांठ का इलाज

अध्यापकवशिक्षार्थीकासामान्यसंवादनहोनेसेएकतरफ़ाजैसीस्थितिरहतीहैजोकिसीखने-सिखानेकेलियेठीकनहींमानीजासकती तोदोस्तोंयहलेखथाऑनलाइनशिक्षाकेफायदेवनुकसानOnlineEducationAdvantagesDisadvantagesInHindi,OnlineShikshaKeFaaydeAurNuksanHindiMe. बनानेकातरीकायहांपढ़ें.

आगे की

नस दबने का क्या इलाज है

पलाश-तैलकामधुकेसाथ,1तोले,दूधकेसाथप्रतिदिन6मासतकसेवनकरनेसेआयु5सौवर्षहोजातीहै।(4). आंवलाआंखोंकीरोशनीबढ़ानेमेंभीमददगारहै.

आगे की

लौ बाप का इलाज

आपभीपिछलाकड़वाअनुभवभूलकरआगेबढ़नेकीकोशिशकरें. जोसुरक्षितसॉस(Sauce)खानेकीआपकोछूटहैवोहैसोयासॉसऔरपुदीनाचटनीशामिलहैलेकिनबिनाचीनीके यादरखेंकिआपयहअपनेलिएकरेंगेहैंनकीकिसीऔरकेलिए पहलेमैंनेएकअंडाखानाशुरूकियाफिरदोऔरअबतीनअंडे।Carbsखानेकीप्रबलइच्छाकोसंतुष्टकरनेकेलिएअंडेसबसेजयादासुविधाजनकहैं।कुछउबलेहुएअंडोकोफ्रिजमेंरखलेजिसेआपहलकेभजोनकीतरहखासकतेहैं।प्याजऔरटमाटरकेसाथआमलेटखानेकीबजायेमैंनेहराधनियाऔरपुदीनेकीचटनीकेसाथसादाआमलेटखातीहूं मैंहमेशासेहीअंडेकीशौकीनरहीहूं,इसलिएजायदसोचनेकीजरुरतनहींथी।उबलेहुएअंडेभीखासकतेहैं,भुर्जी(Scrambled),सनीसाइडउप(SunnySideup),दोनोंतरफसेतलाहुआ,औरऑमलेटबनासकतेहैं आपकीजानकारीकेलिएआपकोबतादेंकिप्याजऔरटमाटरखासतौरपरकच्चेप्याजऔरटमाटरमेंचीनीकीमात्राअधिकहोतीहैऔरइसेकीटोआहारमेंशामिलनहींकियाजासकता।नाश्तामेंआपअन्यप्रोटीनशामिलकरसकतेहैं!आपबेकन,हैम,कबाब,सलामी,सौसेजिस(Sausages)यहाँतकचिकनकेस्लाइसजोड़सकतेहैं।औरयादरखियेकीआपउतनाहीखासकतेहैंजितनाकीआपकोफैट,प्रोटीनऔरकार्ब्सखानेकीसीमाहो जोसुरक्षितसॉसखानेकीआपकोछूटहैवोहैसोयासॉसऔरपुदीनाचटनीभीशामिलहैलेकिनबिनाचीनीके।इसबातकोलिखलेंकिआपअपनेनाश्तेकेमेनूमेंहरीपत्तेदारसब्जियोंकोजोड़सकतेहैं,भलेहीमैंनाश्तेमेंपत्तेदारआहारनहीखासकती।फिरभीआपहरेमटरकोखानेसेबचेंक्योंकिइसमेंकार्बोहाइड्रेटकीमात्राअधिकहोतीहै।अगरआपसुबहनाश्ताअच्छीतरहसेकरतेहैंतोआपपुरेदिनलंबेसमयतकभूखमहसूसनहींकरेंगे।कृपयाबहुतसारापानीपीजियेजिससेआपकेशरीरकेफैट्सपहलेदिनसेनिकलनाशुरूहोजायेंगे।खुदकोअच्छीतरहसेहाइड्रेटेडरखें कीटोडाइटसिर्फहेल्थएक्सपर्टऔरडॉक्टरकीसलाहसेहीशुरूकरें।पहलेआपअपनेडॉक्टरसेसलाहलेंकीक्याआपकीटोडाइटपरजानेयोग्यहैंयानहीं।आपपहलेयहपताकरलेंकीक्याआपकाशरीरइतनेसख्तआहारप्लानकोअपनानेलायकहैयानहींऔरजबआपकोआपकेडॉक्टरअनुमतिदेंतभीआपकोकीटोडाइटशुरूकरनाचाहिए प्रश्नकीटोडाइटमेंक्यापीसकतेहैं.

आगे की

बाबा रामदेव हार्ट ब्लॉकेज मेडिसिन इन हिंदी

लेकिनयदिऐसाबार-बारहोताहैऔरलंबेसमयतकयहस्थितिबनीरहतीहैतोध्यानदेनेकीजरूरतहै?

आगे की

खून में संक्रमण

तेजीसेवजनकमकरनेवालीयहसुपरड्रिंकतैयारहै.

आगे की

एबीपी न्यूज़

नमस्कारदोस्तोंआजकापोस्टबहुतहीज्यादाजरूरीहैक्योंकिआजहमआपकोबतानेवालेहैंकिवजनयामोटापाकमकरनेकेलिएआपकोक्याखानाचाहिएऔरकौनसीडाइटप्लानफॉलोकरनीचाहिए? इम्युनिटीमजबूतकरनेकेलिएआयुर्वेदभीएकबेहतरविकल्पहै।दालचीनीऔरनींबूसेबनाकाढ़ानासिर्फइम्युनिटीकोमजबूतकरताहै।?

आगे की

रक्त के घटकों के नाम लिखो

नेअंतत:निम्नलिखितसिफारिशकी: प्रायद्वीपीयक्षेत्रमेंबार-बारपड़नेवालेसूखेकाकारणक्षेत्रकेअनेकइलाकोंकावर्षाछायाक्षेत्रमेंपड़नातथाइसक्षेत्रकीनदियोंकामौसमीस्वरूपकाहोनाहै परअमलकरनेकावादाकियाहै-जैसेकिआवश्यकवस्तुअधिनियममेंबदलाव,जिससेभंडारणमेंनिवेशसहजहोगा,एकक़ानूनीढांचाजिससेअनुबंधखेतीकीअनुमतिहोगी,जोफसलबुवाईकेसमयकिसानकेलिएएकतयदामसुनिश्चितकरेगी,औरएककेंद्रीयक़ानूनजोअंतर-राज्यीयव्यापारववाणिज्यकेबीचकीबाधाओंकोहटाकरएकनेशनलफूडमार्केटतैयारकरेगा.

आगे की

धमनी और शिरा क्या होती है

आपकीउम्मीदसेबहुतज्यादाएल्कोहलमेंकैलोरीबढ़तीहै. गुनगुनेपानीकेसाथनींबूऔरशहदडालकरपीनेसेवजनघटताहै.

आगे की

मस होने की दवाई बताइये

नीचेकीओरझुकनेपरपेटपरदबावपड़ताहैजिससेआपकापेटटोनहोताहै.

आगे की

पीयूष ग्रंथि अंग्रेजी अर्थ

Issebachnekeliyeaurmotapesechutkarapanekeliyedinbharmekhoobpaanipiye. फोटो:गूगलफ्रीइमेज डॉक्टरोंकाकहनाहैकिबालोंकेगीलेरहनेसेइसकीऊपरीपरतवाले'क्युटिकल्स'कोक्षतिपहुंचतीहैंजिससेबालोंकोनुकसानपहुंचताहै.

आगे की

२द इको टेस्ट नार्मल रिपोर्ट

कुछव्यक्तिवजनकेप्रतिअत्यधिकसजगरहतेहैंऔरवजनकमकरनेकीसनकमेंबेवजहअत्यधिकडायटिंगकरतेहैं,अत्यधिकव्यायामकरतेहैं.

आगे की

बांग्ला में घर पर उच्च रक्तचाप उपचार

इसलिएइन्हेंकममात्रामेंहीले.

आगे की

बीपी को कम करने के लिए घरेलू उपाय

अजवाइनकासहीमात्रामेंइस्तेमालसेहतऔरसौंदर्यकोबेहतररखताहै. तनाव,पानीकीकमी,खानेवएक्सरसाइजकेबीचमेंगैपऔरवर्कआउटकीकठिनतापरभीयहनिर्भरकरताहै.

आगे की

प्राकृतिक बाईपास सर्जरी

इससेभूखकमलगेगीऔरजबभूखकमलगेगीतोआपखानाकमखाएंगे.

आगे की

एबीपी न्यूज़ समाचार लाइव

सभीपैकेटवालीचीजोंमेंप्रिजर्वेटिवपाएजातेहैं,जोसेहतकोनुकसानपहुंचानेकेसाथ-साथवजनभीबढ़ातेहैं. इसेएक-एकचम्मचदिनमेंदोसेतीनबारबच्चोंकोपिलातेरहें,इससेउनकीपेटसंबंधितसभीदिक्कतेंठीकहोजाएगी.

आगे की

बाप लौ सिम्पटम्स इन हिंदी

साथहीटॉक्सिंसशरीरसेबाहरनिकलनेमेंभीयहमददकरताहै.

आगे की

हार्ट अटैक के लिए योग

कीटोडाइटकापालनऔरस्थानीयभारतीयफूडकेइस्तेमालसेनतीजेदिखसकतेहैं. बताएंगे.

आगे की

ट्रॉप टी परीक्षण सकारात्मक उपचार

संतरेमेंसमाएंहैंसौंदर्यऔरसेहतकेकईलाभ जैतूनकातेलहैहेल्थवसौंदर्यकेलिएगुणकारी.

आगे की

होम्योपैथिक दवा की लिस्ट

बाजारकाAmlaएवंत्रिफलाअसरक्योंनहींकरता.

आगे की

मधुमेह की समस्या निम्न के कारण होती है

लोगकब्जजैसीसमस्याओंसेघिरजातेहैं.

आगे की

हाइपरटेंशन से बचने के उपाय

हमआपकोबतातेहैंहमारेघरमेंहीरखेयेउपायजोआपकोपेटकीचर्बीकमकरनेमेंमददकरसकतेहैं. रानीचटर्जीकेवजनकमकरनेकीकहानीबहुतप्रेरणादेतीहै।वोअपनेवजनकोलेकरशुरूमेंतोखुदसेहीभागती.

आगे की

கிறிஸ்தவ பாடல் டவுன்லோட்

लेकिनकुछहीदिनोंबादउनकावजनऔरमोटापाफिरसेबढ़नेलगजाताहैयहइसवजहसेहोताहैक्योंकिवहलोगफिरसेवहीसबचीजखानाशुरूकरदेतेहैंजोकिवजनऔरमोटापेकोबढ़ावादेताहै. ज्यादातरलोगोंकोमोटापा(Obesity)याशरीरकीचर्बीघटानाबहुतमुश्किललगताहै.

आगे की

Binableeala गीत मुफ्त डाउनलोड

हिपजौइंटकीहीतरहकामकरताहै. ग्रा.

आगे की

बीपीएल राशन कार्ड ऑनलाइन आवेदन

व्यायामऔरसामान्यदैनिकगतिविधियोंकेलिएआवश्यकतासेअधिककैलोरीलेनेकेपरिणामस्वरूपअक्सरमोटापाबढ़ताहै.

आगे की

सुबह सबसे पहले कौन जगाता है

यहछोटासाआसानप्रयोगएकमहीनेमेंआपकेपेटकोकमकरदेगाऔरलगातार6महीनेतकइसप्रयोगकोकरोगेतोआपकामोटापा,पेटबिलकुलसामान्यहोजायेगासारामोटापाखत्महोजायेगा. टमाटरमें9-oxo-ODAनामकएकयौगिकपायाजाताहै।यहखूनमेंलिपिडकमकरनेकाकामकरताहै।इससेपेटकीचर्बीकमहोजातीहै 4.

आगे की

ट्रोपोनिन मैं परीक्षण लागत

जिससेकब्जकीसमस्याधीरे-धीरेकमहोनेलगतीहै.

आगे की

हिंदी में इको कार्डियोलॉजी

येबॉडीकेएक्ट्राफैटकोकमकरताहै.

आगे की

आयुर्वेद पतंजलि में कोलेस्ट्रॉल चिकित्सा

आजकेदिनपितायापितातुल्यव्यक्तिसेआपकोपूर्णसहयोगमिलेगा.

आगे की

हिंदी में बीपी कम लक्षण

शामको4:00बजेनारियलपानीपीएंऔरअंगूरयातरबूज़खाएं 5!

आगे की

उच्च रक्तचाप से पीड़ित व्यक्ति को कम नमक

अबअपनीupperbodyकोabdomen(पेट)केजरियेऊपरउठाये!

आगे की

ट्राइग्लिसराइड्स ब्लड टेस्ट कनाडा

आपकोखानाखानेकेबादकमसेकम१०से१५मिनटचलनाचाहिएइससेआपकाखानापचनेमेंमद्ददहोतीहैऔरआपकापेटबहारभीनहींनिकलताहै. रोगप्रातिरोधकक्षमताबढ़ाताहैं,तव्चाकोचमकदारबनताहैं,हड्डियोंकोमजबूतकरताहैं,दिमाग़औरतंत्रिकातन्त्रकोसुद्रढ़करताहैं,सूचीबहुतलंबीहैंइसकी.

आगे की

सुबह सबसे पहले कौन जाता है बताइए

25करोड़रूपएकाराजस्वप्राप्तहुआहै।पिछलेवित्तीयवर्ष-20में10.

आगे की

खून बढ़ाने की सिरप कौन सी है

वजनघटानेकेलिएदलियाभीमहत्वपूर्णस्त्रोतहै.

आगे की

पतंजलि दिव्या कायाकल्प वटी हिंदी

इसकेसाथहीयहमोटापे(Obesity)सेपरेशानलोगोंकेलिएभीफायदेमंदहै.

आगे की

सुबह सबसे पहले कौन जागता है

टमाटरकाउपयोगहरकोईअपनेसब्जीमेंकरताहै. दोस्तोंयदिआपकोअपनापेटजल्दीसेजल्दीफ्लैटकरनाहैतोइसकेलिएआपकोतेलसेबनीहुईचीजोकोखानाबंदकरनाहोगा.

आगे की

रक्तचाप स्तर चार्ट आयु के अनुसार

अपनेआहारमेंअधिकफलऔरहरीपत्तेदारसब्जियोंकोशामिलकरें।इनसेआपकाेसभीजरूरीपाेषकतत्वमिलजांएगे।हरीपत्तेदारसब्जियांजैसेकेल,पालक,कोलार्ड,स्विसचार्टआदिवजनकमकरनेवालेआहारकेतौरपरएकदमसहीहैं।क्योंकियेकैलोरीऔरकार्बोहाइड्रेटमेंकमऔरफाइबरमेंउच्चहोतीहैं।इनकासेवनकैलोरीबढ़ाएबिनाभोजनकीमात्राबढ़ानेकाएकशानदारतरीकाहै।इनमेंकैल्शियमसहितकईविटामिन,एंटीऑक्सिडेंटऔरखनिजहोतेहैंजोफैटबर्नरकेतौरपरकामकरतेहै।डाइटमेंहरीपत्तेदारसब्जियांकासेवनजल्दहीआपके6पैक्सएब्सकीचाहतपूरीकरसकताहै कईअध्ययननींदकीकमीऔरवजनबढ़नेकेबीचजुड़ेहुएहैं।एकरातमेंसातसेआठघंटेकीनींदलेनेकीकोशिशकरें।सोनेसेपहलेएकउपन्यासपरध्यानदेनायापढ़नाआपकोएकअच्छीनींदलानेमेंमददकरसकताहै शोधकर्ताओंकाकहनाहैकिडाइटमेंप्रोटीनकासेवनबढ़ानेसेवजनकमकरनेमेंमददमिलसकतीहै,साथमांसपेशियोंकाविकासहोताहै।प्रोटीनकाअच्छास्रोतचुनें,जैसेकिलीनमीट,सीफूड,लो-फैटडेयरीऔरनट्स पेटकीचर्बीकमकरनेकेलिएआपकोखानाबंदनहींकरनाचाहिए।भूखारहनेसेशरीरमेंकमजोरीआतीहै।बसआपकोयेध्यानरखनाहैकिआपक्याखारहेहैं।अपनीडाइटसेप्रोसेस्डफूडऔरकार्ब्सकाेदूररखें।हां,हेल्दीकार्ब्सपोषणकेलिएजरूरीहैं।क्योंकियेआपकोएनर्जीदेतेहैं मोटापाकमकरनेकेलिएफ्रूटजूसकोनाकहिए,क्योंकिअधिकांशफलोंकारसउच्चचीनीसामग्रीकेसाथआताहै।यदिआपवजनघटानेकाप्रयासकररहेहैंतोअपनेपेयसेचीनीकोपूरीतरहसेकाटलें।स्पोर्टड्रिंकसेभीबचें,इनमेंसोडाकैनजितनीचीनीहोतीहै।भरपूरपानीपीनाआपकेशरीरकोहाइड्रेटऔरसाफरखनेकेलिएसबसेअच्छातरीकाहै।जूसकीजगहपरफलोंकासेवनकरेंउनमेंपायाजानेवालाफाइबरआपकेपाचनकोसहीरखकरमोटापाकमकरनेमेंमददकरताहै वजनकमकरनेकेलिएकार्डियोमहत्वपूर्णहै।लेकिनआपकोस्ट्रेंथट्रेनिंगकोभीशामिलकरनाचाहिए,यदिआपकाउद्देश्यउसबेलीफैटकोवॉशबोर्डएब्समेंबदलनाहै।ऐसाइसलिएहैक्योंकिमांसपेशियोंमेंवसाकीतुलनामेंअधिककैलोरीजलतीहै।फिटनेसविशेषज्ञसप्ताहमें5दिनोंकेलिएदिनमेंकमसेकमआधेघंटेपैदलचलनायाबाइकचलानेजैसीमध्यमगतिविधिऔरसप्ताहमेंदोबारस्ट्रेंथट्रेनिंगकरनेकासुझावदेतेहैं मोटापाकमकरनेकेलिएफ्रूटजूसकोनाकहिए,क्योंकिअधिकांशफलोंकारसउच्चचीनीसामग्रीकेसाथआताहै।यदिआपवजनघटानेकाप्रयासकररहेहैंतोअपनेपेयसेचीनीकोपूरीतरहसेकाटलें।स्पोर्टड्रिंकसेभीबचें,इनमेंसोडाकैनजितनीचीनीहोतीहै.

CHILDREN-INFANTSTREATMENTबालरोगचिकित्सा:: नचमत्स्थानिभूतानिपश्यमेयोगमैश्वरम्।भूतभृन्नचभूतस्थोममात्माभूतभावनः॥9.

आगे की

कोच्चि मुजिरिस बिएननेल लोगो का अर्थ है

खानेमेंसभीतरहकेपोषकतत्वोंकोशामिलकरें एककटोरेपानीमेंसूखेअंजीरकेटुकड़ेऔरकिशमिशकोडालकररातभरभिगोकररखें।प्रातःकालउठकरखालीपेटअंजीरऔरकिशमिशकासेवनकरेंतथाअंजीरऔरकिशमिशखानेकेएकघंटेबादगुनगुनेदूधकासेवनकरें।यहप्रकियारोजकरनेसेकुछहीहफ़्तोंमेंआपकोदुबलेपनकीसमस्यासेछुटकारामिलजायेगा दुबलेहोनेकेकईकरणहोसकतेहैंहैंजोकिइसप्रकारहैं प्राचीनकालसेहीअश्वगंधाऔरशतावरीकाउपयोगअनेकगम्भीरबिमारियोंकोठीककरनेकेलिएकियाजातारहाहै।बतादेंकिअश्वगंधाऔरशतावरीमोटापाबढ़ानेकेलिएलाभकारीऔषधिहैं।यहऔषधिनसिर्फआपकोमोटाबनातीहैबल्किशरीरमेंमौजूदकईतरहकीबीमारियोंकाखात्माभीकरतीहै।तोआइयेजानतेहैंमोटाहोनेकेलिएइनदोनोंऔषधियोंकाप्रयोगकैसेकरनाहै 14.

वीडियो:सेहत:अगरमोतियाबिंदहै,तोक्याइसकाइलाजसिर्फसर्जरीहै.

आगे की

ब्लड प्रेशर मशीन का क्या नाम है तथा इसके कितने भाग होते हैं

रोजानाअश्वगन्धाकासेवनजरुरकरे.

आगे की

धमनी और शिरा में अंतर ४

इसमेंफाइबर,आयरन,कॉपर,कैल्शियम,पोटैशियम,मैगनीज,जिंकवमैगनीशियमजैसेमिनरल्समौजूदहै. अच्छेऔरजल्दीपरिणामपानेकेलिएअपनीडाइटमें30उबलाहुआखाना,30सलादऔर40भोजनले।खानापकानेकेलिएनारियलतेलकाइस्तेमालकरे सेजुड़ेसुझावहैतोहमारेसाथसाँझाकरें 7.

आगे की

हब कितना होना चाहिए

फाइबर,मैग्निशियम,एंटीऑक्सीडेंटऔरआयरनकेगुणोंसेभरपूरआमभूखकोनियंत्रितकरनेमेंमददकरसकताहै. डीएआरयूजर्नलऑफफार्मसूटिकलसाइन्सकेअध्ययनकेप्रकाशनकेअनुसारत्रिफलावज़नघटानेकीप्रक्रियाकोगतिदेताहै।अध्ययनकेतथ्यकेअनुसार5ग्रामत्रिफलाकेसेवनसेकुछहीहफ्तोंमेंवज़नघटायाजासकताहै।साथहीआपकोयहजानकरखुशीहोगीकिआपकीमोटीकमरभीपतलीहोसकतीहै।इसकाकोईसाइडइफेक्टभीनहीहै आचार्यबालकृष्णकेअनुसारएकछोटाचम्मच(5ग्राम)त्रिफलाचूर्णकेमिश्रणमेंएकचम्मचशहदमिलाकरकुछदिनोंतकइसकासेवननियमितरूपसेकरनाचाहिए यहमानागयाहैकिइसमेंअलग-अलगजड़ी-बूटियोंकेमिश्रणसेइसकाचिकित्सीयप्रभावबढ़जाताहै।यहअकेलेलिएगएकिसीएकघटककीतुलनामेंअधिकशक्तिशालीउपचारहै वातदोषकोआसानीसेठीककरताहैत्रिफला,जानेंकैसे एकछोटाचम्मचत्रिफलापाउडरलेंऔरउसकोएकबर्तनमें200मिलीलीटरपानीलेकररातभरभिगोकररखें(8घंटेतक)।अगलेदिनसुबहइसमिश्रणकोतबतकउबालेंजबतककिपानीआधानहोजाय।आंचसेउतारकरपीनेलायकठंडाहोनेकेलिएरखदें।इससेपावडरतलहटमेंबैठजायेगा।अबपानीकोनिथारलेंयाछानकरउसमेंएकचम्मचशहदडालकररोजसुबहखालीपेटपियें अगरआपवेटलॉसकेलिएगिलोयकेजूसकासेवनकरनाचाहतेहैंतोआधेग्रामगिलोयकेजूसमेंएकचम्मचशहदमिलाएंऔरइसमिश्रणकोहरदिनसुबहखालीपेटपिएं।आपचाहेंतोइसेबटरमिल्कयानीछाछकेसाथभीपीसकतेहैं।ऐसेकरनेसेआपकोवजनघटानेमेंमददमिलेगी गिलोयएकआयुर्वेदिकजड़ीबूटीहैजोअपनेचिकित्सीयगुणोंकीवजहसेदवाकेरूपमेंइस्तेमालकीजातीहै।गिलोयकीपत्तियां,फूल,जड़औरतनासबकुछहीऔषधीयगुणोंसेभरपूरहैऔरहरतरहसेफायदेमंदभी।गिलोयकेऔषधीयगुणोंकीवजहसेइसेअमृतकेरूपमेंजानाजाताहै।इसकीपत्तियांहार्टकेशेपकीहोतीहैजिसवजहसेइसेheart-leavedmoonseedभीकहाजाताहै।यहांजानें,गिलोयकेफायदोंकेबारेमें.

आगे की

रक्तचाप उच्च अपचर हिंदी

आजजब7500वेकेंद्रकालोकार्पणकियागयाहैतोवोशिलॉन्गमेंहुआहै.

आगे की

सुबह क्या करना चाहिए

अगरखालीपेटआपगर्मपानीमेंदोचम्मचशहदमिलाकरपीतेहैंतोकुछहीहफ्तोंमेंआपकावजनकमहोनेलगेगा. मोटापेसेमुक्तिअसंभवनहीँहै.

आगे की

क्या करे क्या न करे आसाराम बापू

लेकिनहमआपकोकुछघरेलूउपायबतनाजारहेहै,जिसकीमददसेआपआसानीसेअपनावजनकमकरसकतेहैं.

आगे की

लो ब्लड प्रेशर के लक्षण बताइए

वास्तविकतामेंसेबसाइडरसिरकाकेसेवनकेलिएदिनकेएकविशेषसमयकासपोर्टकरनेकेलिएअभीतककोईवैज्ञानिकप्रमाणनहींहै. विकासबहलद्वारानिर्देशित,'गुडबाय'कानिर्माणबालाजीटेलीफिल्म्सऔररिलायंसएंटरटेनमेंटद्वाराकियागयाहै,जिसमेंअमिताभबच्चनऔररश्मिकामंदानामहत्वपूर्णभूमिकानिभारहेहैं.

आगे की

कम रक्तचाप देसी ilaj

इसकेसेवनसेएकओरजहांमोटापाबढ़ताहैवहींऐसीचीजेंमीठेकोलेकरक्रेविंगबढ़ानेकाभीकामकरतीहैंजोखतरनाकहोसकताहै अगरआपवाकईमोटापाकमकरनेकोलेकरगंभीरहैंतोसबसेपहलेयहसुनिश्चितकीजिएकिआपजोभीकुछखाएंउसमेंकार्बोहाइड्रेटकीमात्राकमहो।यहबातकईशोधमेंभीसाबितहोचुकीहैकिज्यादाकार्बोहाइड्रेटवजनबढ़नेकाकारणहोतेहैं कमवसावालेदूधकाप्रयोगकरेंक्योंकिइसमेंवसाकमहोनेकीवजहसेकैलोरीकमहोतीहैजबकिकैल्शियमज्यादाहोताहैऔरयहअतिरिक्तकैल्शियमवजनकोघटाताहै।इसकेलिएगायकायाबकरीकादूधकाउपयोगकरनाफायदेमंदहोताहै किसीकाभीमोटापाएकदिनमेंतोबढ़नहींजाता।ऐसेमेंयेसोचनाकिएकदिनमेंहीमोटापाकमहोजाएगलतहोगा.

आगे की

हिंदी में रक्तचाप नियंत्रण युक्तियाँ

इलायचीसिस्टोलिकऔरडायस्टोलिककोकमकरनेमेंसहायतहै.

आगे की

शुद्ध रक्त कहां पाया जाता है

भारतीयबारकाउंसिलसदस्योंकोपरिचालितकार्यसूचीकेअनुसारनियमितअंतरालोंपरबैठकेंकरतीहै।इनबैठकोंमें,काउंसिलधारा26(1)केअधीनउनमामलोंमेंनिष्कासनकीकार्यवाहियांभीकरतीहै,जिनमेंअन्यथाकथनअथवामहत्वपूर्णतथ्योंकोछिपाकरकिसीव्यक्तिकानामांकनकियागयाहो;औरराज्यबारकाउंसिलोंसेधारा26(1)केअधीनप्राप्तऐसेनिर्देशोंकानिपटानभीकरतीहै,जिनमेंराज्यबारकाउंसिलद्वाराकिसीकारणवशनामांकनकेआवेदनकोरद्दकरनेकाप्रस्तावकियागयाहोताहैतथाअधिवक्ताअधिनियम,1961कीधारा48(क)केअधीनउनमामलोंमेंपुनरीक्षणयाचिकाओंकीसुनवाईऔरनिर्णयभीकरतीहै,जिनमामलोंमेंअधिवक्ताओंकेविरुद्धव्यावसायिकअथवाअन्यकदाचारकीशिकायतोंकोराज्यबारकाउंसिलद्वारासरसरीतौरपरखारिजकरदियागयाहोताहै यहशोधअमेरिकनजर्नलवऑफ़पब्लिकहेल्थमेंछपाहै.

आगे की

हाई ब्लड प्रेशर को कम करने के घरेलू उपाय

इसेपीनेसेआपकापेटलंबेसमयतकभरारहताहै! हिंदीवेबबुकअपनेप्रियपाठकोंकोबहुमूल्यजानकारियाँउपलब्धकरानेकेलियेसमर्पितहै,हमअपनेइसकार्यमेंउनकेसमर्थनऔरसुझावकीअपेक्षाकरतेहै,ताकिहमारायहप्रयासऔरबेहतरहोसके देसीघरेलूउपायडाटकॉममेंआपआपसभीकास्वागतहै।मेंघरेलूउपाय,घरेलूउपचार,घरेलूइलाजएवंनुस्खे,आयुर्वेदिकउपचार,ज्योतिषकेउपाय,वास्तुदोषकेनिवारणकेउपाय,फेंगशईकेउपाय,आस्थाऔरधर्मसेसम्बंधितउपायोंकेबारेमेंजानकारीसंग्रहितकीगयीहै आलसकोदूरभगानेकेलिएव्यायामज्यादाजरूरीहै.

आगे की

वहिका क्या होती है

इसलिएलोगइन्हेंजमकरशेयरभीकरतेहैं. कभी-कभीखांसीऔरजुकामकोहल्कालेनाहमेंभारीपड़सकताहै।खासकरजबवैक्सीनकेबादभीकोरोनावायरसकेमामलोंमेंइजाफाहोरहाहो।ऐसेमेंबदलतेमौसमकीबीमारियांमानकरखांसी-जुकामकोअनदेखाकरना.

आगे की

बुलड सॉन्ग गीत।

आइएआपकोबताएंकिआपकोऐसाक्याकरनाचाहिएकियेसमस्यानहोयाफिरयदिहोगईहैतोयहकमहोजाए.

आगे की

इको एल्वेफ 60-65।

इन्हेंखानेकेबादखानेसेपेटजल्दीभरजाएगाऔरवजननियंत्रितहोजाएगा.

आगे की

र ४१ होम्योपैथिक मेडिसिन बेनिफिट्स

गरमचाय,बिनादूधऔरशक्करकेआपसेवनकरेतोभीयहफ़ायदामिलेगागरमपानीसेपाचनतंतरासुधरजाताहैऔरगतिविधिबढ़तीहैजिससेआपकाशरीरचर्बीकोअच्छीतरहसेउपयोगकरकेजलादेताहैपेटकमकरनेकेघरेलूउपायमेंएकश्रेष्टउपायहैकीआपहररोजभोजनकेसाथकच्चेपपीताकासेवनकरेकदुकसकरकेखाएखानाखानेकेबादपक्कापपीताखानेसेभीअत्यंतलाभहोताहैसवेरेउठकेखालीपेटकरेलेकाजूसपीनायानेआपचर्बीकोआसानीसेपिघलासकतेहैइसप्रश्नसेपरेशाननारहे.

आगे की

वेनिस बिएननेल 1986

अन्यलेखोंमें,मोटापाघटानेकेदिनचर्याबदलाववआहारोंकीचर्चासमयसमयपरकीगयीहै.

आगे की

कच्चा मूंगफली खाने के फायदे और नुकसान

आपकाशरीरफैटकोहीउपयोगमेंलीजानेवालीएनर्जीमेंकन्वर्टकरताहैं.

आगे की

कार्डियोलॉजी हिंदी में अर्थ है

इसकेअलावामछली,मीटऔरपॉल्ट्रीकेब्रेडेडप्रोडक्ट्ससेबचनाचाहिए.

आगे की

असामान्य ईसीजी रिपोर्ट

यूरिनसंबंधीरोगोंकेलिएयहऔषधिकाफीफायदेमंदहैयहमूत्रमार्गकीसमस्याओंकोदूरकर,पेशाबकेमाध्यमसेशरीरकीगंदगीकोभीसाफकरतीहै.

आगे की

भैंस का घी कितने रुपए किलो है

रातअच्छीनींदलेनेकेबादभीऑफिसमेंआपकोनींदऔरउबासीआनेलगतीहै।आपचाहकरमोटापाकमकरनेकेचक्करमेंनापिएंज्यादानींबूपानी,होसकतेहैंयेनुकसान.

आगे की

लो ब्लड प्रेशर में क्या नहीं खाना चाहिए

दोपहरकेसमयमेंएक्टिविटीलेवलबहुतहीज्यादारहतीहैजिसकीवजहसेआपकेशरीरकीकैलोरीजल्दी-जल्दीबर्नहोतीरहतीहै.

आगे की

हार्ट क्या है

जीराकेपानीमेंपोटैशियम(Potassium)भीउच्चमात्रामेंपायाजाताहैऔरसोडियमयानीनमककेनेगेटिवअसरकोकमकरनेऔरब्लडप्रेशरकोकंट्रोल(BPControl)करनेकेलिएपोटैशियमसबसेजरूरीहै! पानीमेंकॅलरीजनहींहोतीहै!

आगे की

हिंदी में आयुर्वेद में बीपी उपचार

दोनोंहाथकमरसेसटेहोनेचाहिएऔरअपनीगर्दनसीधीरखें. इनमेंप्रोटीनपाउडर्स,बार्सऔरमल्टिविटामिन्सशामिलहैं.

आगे की

भारत में ओमॉन बीपी मॉनीटर मशीन की कीमत

आपसलादमेंइसकासेवनकरसकतेहैंयाकुछपेयपदार्थोंमेंइसकीथोड़ीमात्रामिलाकरपीसकतेहैं.

आगे की

एंजियोग्राफी कैसे होती है

अनुमानकेलिएएकसामान्यआकरकाबादामलगभगएकग्रामकाहोताहैं.

आगे की

रक्तचाप या ब्लड प्रेशर क्या है

GMडाइटकाआखरीवमहत्वपूर्णदिनहै. दोस्तोंआजकलबाजारमेंweightबढ़ानेकेसप्लीमेंट्सभीआतेहै,अगरआपभीकोईसप्लीमेंटइस्तॆमालकररहेहैतोनियमितरूपसेएक्सरसाइजऔरव्यायामजरूरकरे,क्योंकिहमनेकईलोगोकोयेकहतेसुनाहैकीसप्लीमेंटबंदकरनेकेबादबॉडीढीलीपड़जातीहैपरनेचुरलतरीकेसेवजनबढ़नेपरऐसानहींहोता सरमेभीचहाताहूँमोटाहोनाबहुतपतलाहूँ दोस्तअगरआपवजनबढ़ानाचाहतेहैतोऊपरलिखेहुएघरेलूटिप्सपढ़ेऔरअपनाये.

आगे की

उम्र के हिसाब से उच्च रक्तचाप चार्ट

कईअध्ययनोंसेपतायहचलाहैकिअगरदिनमें3से5कपपीनेग्रीनटीलीजाएतोतकरीबन40फीसदीअतिरिक्तवसाकोकमकियाजासकताहै.

आगे की

हिन्दी में उच्च रक्तचाप के लक्षण

इसकेबादआपजनऔषधिकेंद्रकाआवेदनकरनेकेलिएरजिस्टर्डहोजाएंगे.

आगे की

हिंदी वीडियो में कम रक्तचाप

यादरहेकिबाएंहाथकीहथेलीकोबाएंपैरसेअलगनहटनेपाए. जिसमेंकैंसरहृदयसंबंधीसमस्याएंइसतरहकीऔरभीबहुतबीमारियांहोसकतीहै?

आगे की

हथियार बढ़ाने वाला दवा

'मुझेपताहैपरअपनासमयदेकरइससमस्याकेबारेमेंबतानेकेलिएशुक्रिया.

आगे की

हिंदी में कुल कोलेस्ट्रॉल का अर्थ

आपसभीजानतेहैकीआयुर्वेदिकऔरघरेलूनुस्खेहमारेलिएकितनाफायदेमंदहैऔरइनकाकिसीतरहकासाइडइफ़ेक्टनहींहै. प्रतीकात्मकतस्वीर) लोगपतलातोहोनाचाहतेहैं,लेकिनउसकेलिएगंभीरतासेकिसीनियमकापालननहींकरपाते.

आगे की

क्या पाकिस्तान युद्ध करना चाहता है

जानकारोंकेमुताबिकहरीइलायचीशरीरकेचयापचयकोबढ़ाकरआपकेपाचनतंत्रकोसाफ,शरीरकीसूजनकोकमकरनेऔरकोलेस्ट्रौलकेस्तरकोकमकरतीहै. इसेचबानेसेआपकोतमामफायदेमिलतेहैं.

आगे की

एलडीएल कोलेस्ट्रॉल कितना होना चाहिए

यहध्यानमेंरखाजानाचाहिएकिडायटिंगकेआरंभीचरणोंमेंवजनशीघ्रतासेकमहोसकताहै.

आगे की

पवनमुक्तासन के प्रकार

इलायचीमेंपोटेशियम,कैल्शियम,मैग्नेशियमजैसेखनिजपदार्थपाएजातेहैं!

आगे की

हाई ब्लड प्रेशर का घरेलू उपाय क्या है

इससेकईबीमारियोंकेइलाजमेंसहायकहोताहै,लेकिनइसकेसेवनकातरीकाहरबीमारीकेहिसाबसेअलगहै? रातमेंशारीरिकमेहनतलोगनहींकरतेजिसकीवजहसेज्यादाकैलोरीभीबर्ननहींहोपाती.

आगे की

नेचुरल बाईपास सर्जरी

येआसनछोटीआंत,बड़ीआंतऔरपाचनक्रियामेंफायदाकरतीहै 1. इसकेलिएआपघरपरऔरभीसाधारणउपायकरसकतेहैं!

आगे की

ब्लड प्रेशर कंट्रोल करने का घरेलु उपाय

लहसुनशरीरमेंउनहॉर्मोन्सकोसक्रियकरनेकाकामकरताहैजोफैटकोजमनेनहींदेते. 7302नएकोरोनामरीजोंकीपुष्टिहोनेकेबादप्रदेशमेंअबकुलकोरोनामरीजोंकाआंकड़ा3लाख76हजार348होगयाहै।छत्तीसगढ़मेंअबतक3लाख27हजार689मरीजस्वस्थहुएहैं।नएमरीजमिलनेऔरडिस्चार्जहोनेकेबादअबसक्रियमरीजोंकीसंख्या44249होगईहै बतायाजारहाहैकिदूल्हेकोभीगोदलियागयाथाऔरदुल्हनकीअसलीमांकोइसशादीपरकोईऐतराजनहींथा।स्थानीयमीडियाकेमुताबिककरीब20सालपहलेजबदुल्हनकीअसलीमांकोउसकीबेटीनहींमिलीथीतोउसनेएकबच्चेकोगोदलेलियाथा।अबइसीबच्चेसेउनकीअसलीबेटीकीशादीहोगई।दुल्हनकीअसलीमांनेबतायाकिउसनेकईसालतकअपनीबेटीकीतलाशकीथीलेकिनवहनहींमिली दिल्लीमेंचलरहीनीतिआयोगकीगवर्निंगकाउंसिलकीछठवींबैठकमेंमुख्यमंत्रीश्रीभूपेशबघेलवीडियोकॉन्फ्रेंसिंगकेजरिएअपनेरायपुरस्थितनिवासकार्यालयसेशामिलहुए… जिलेमेंसंचालितवनस्टापसेंटरसखीदेरहाहैमहिलाओंकोनयाजीवन 5.

आगे की

ब्लड प्रेशर का इलाज हिंदी में

जीहां,आपकीकिचनमेंहीछुपेहैंमोटापादूरकरनेकाउपाय. तोचलोदोस्तोंस्टार्टकरतेहै.

आगे की

दूध और चावल खाने के फायदे

इसमेंकईतरहकेन्यूट्रिशंसजैसेप्रोटीन,डायट्रीफाइबर,विटामिनसी,विटामिनई,विटामिनके,पोटैशियम,कॉपर,आयरन,मैग्नीशियमऔरजिंकपायाजाताहै.

आगे की

ग्वालियर में कार्डियोलॉजिस्ट डॉक्टर

फोडेफुंसीकानाश जानेंब्रोकलीसेजुडे7अनजानेतथ्योंकेबारेमें फलोंमेंपौष्टिकतत्वहोनेसेअनेकरोगोंसेरखेदूर बरसातमेंहेल्थकी14बातोंकारखेंखासध्यान. इलायचीखानेसेमस्तिष्कमेंडोपेमिननामकरसायनरिलीजहोताहै।जिससेव्यक्तिकोखुशीकाएहसासहोताहै।इसेअच्छेसेचबाकरखानेसेमाइंडरिलैक्समहसूसकरताहै।जिससेदिमागभीतेजहोताहै सिरसेतीनबारघुमाकरकौएकोखिलादेंयेएकचीज,दूरहोजाएगाशनिदोष 4.

आगे की

एबीपी न्यूज़ वीडियो में दिखाएं

सबसेपहलेआवंलोकोछोटेछोटेटुकड़ोमेंकाटिये.

आगे की

भारत में हृदय रोग विशेषज्ञ वेतन

नहींं,Clonidineकोलनेकेबादआपइसतरहकाकामनहींकरपाएंगे क्याह्रदयपरClonidineकाप्रभावपड़ताहै.

आगे की

वैस्कुलर सर्जन क्या होता है

तोचलिएजानतेहैंअश्वगंधाखानेकेफायदेऔरनुकसान,साथहीजानेंगेइससेजुड़ीकुछख़ासबातें.

आगे की

वाहिका मीनिंग

चलिएजानतेहैअश्वगंधाकेफायदे. रातकोसोतेसमयएकगिलासपिंडखजूरकादूधपीनेसेहेल्थअच्छीहोतीहैं।बच्चोंकेलिएभीयहबहुतफादेमंदहोताहैं केलाएकऐसापौष्टिकफलहैजिसमेआयरन,विटामिनबी6,फाइबर,सोडियम,पोटेशियमपर्याप्तमात्रामेंपायाजाताहै।बतादेंकिमानवशरीरकोप्रतिदिनविटामिनबी6कामिलनाअत्यंतआवश्यकहैताकिवहहिमोग्लोबिनऔरइंसुलिनकापूर्णतरीकेसेनिर्माणकरसके।प्रतिदिनकेलाखानेसेमनुष्यकापाचनतंत्रठीकतरहसेकार्यकरताहैंजिसकीवजहसेमनुष्यकोनिश्चितअनुपातमेंभूखलगतीहैतथाउसकावजनबढ़ताहै।दूधऔरकेलादोनोंहीपदार्थपूर्णतःकैलोरीसेभरपूरहोतेहैं।केलाऔरदूधकोसाथमेंखानेसेअत्यधिककैलोरीमिलतीहैजिसकीवजहसेव्यक्तिकुछहीमहीनोंमेंमोटाहोजाताहै मोटाहोनेकेलिएसबसेअच्छेघरेलुउपायहैंजिनकेइस्तेमालसेआपकोकिसीभीतरहकाकोईसाइडइफ़ेक्टनहींहोगाऔरआपजल्दसेजल्दमोटेभीहोजायेंगे।तोदोस्तोंआपकोआजइसपोस्टमेंबताएंगेहममोटाहोनेकेअसरदारउपाय(motahonekeupay)परन्तुउससेपहलेजानतेहैंदुबलेहोनेकेकुछकरणजिनपरध्यानदेनाऔरउन्हेंदूरकरनाबेहदआवश्यकहै दोस्तोंअंजीरमेंकार्बोहइड्रेट,सैल्यूलोज,विटामिनए,सोडियममुख्यरूपसेपायाजाताहै।इसकेअतिरिक्तअंजीरमेंकैलोरीकोतेजीसेबढ़ानेवालेपोषकतत्वपाएजातेहैंजोदुबलेव्यक्तिकोमोटाहोनेमेंमददकरतेहैं।तोआईयेजानतेहैकिसतरीकेसेअंजीरकासेवनकरकेवजनबड़ासकतेंहैं सर्वप्रथमएककांचकाकटोरालें।अबइसकटोरेमेंएकछोटीचम्मचकिशमिश,दोबादामकीमिगी,50ग्राममूंगफली,चारछोटीचम्मचदेशीचनाडालकरपूरीरातभिगोकररखें।सुबहउठकरपानीमेंसेसभीसामग्रीकोनिकाललें।अबइनसभीभीगीहुईचीजोंकारोजसुबहखालीपेटसेवनकरें।इसनुस्खेकेसेवनसेमात्रएकमहीनेमेंहीआपकोफर्कदेखनेकोमिलेगा यदिकोईव्यक्तिसामान्यसेअधिकमोटाहैयासामान्यसेअधिकदुबलाहैतोउसव्यक्तिकोस्वस्थव्यक्तिकीश्रेणीमेंनहींरखाजाताहै।जिसतरहमोटापाअनेकबिमारियोंकीजड़होताहैउसीतरहदुबलाहोनाभीकईघातकबीमारियोंकोजन्मदेताहै।वर्तमानमेंअत्यधिकदुबलाहोनाएकगंभीरसमस्याबनगईहैऔरयहसमस्यालड़केऔरलड़कियोंदोनोंमेंहीसामानरूपसेदेखीजातीहै।अत्यधिकदुबलेहोनेकीवजहसेशरीरकीकार्यप्रणालीठीकसेकार्यनहींकरपातीहैजिसकीवजहसेदुबलेव्यक्तिकोकईगंभीरबीमारियांहोनेकाखतराबनारहताहै जोलोगदुबलेपनसेछुटकारापानाचाहतेहैउनलोगोंकेलिएयहउपायबहुतहीलाभकारीहै।अक्सरदेखाजाताहैकिकुछलोगोंकोभूखनहींलगतीहैजिसकेकारणवहपार्यप्तभोजननहींकरते।पार्यप्तभोजननहींकरनेकीवजहसेउनकोआवश्यकपोषकतत्वनहींमिलपातेऔरउनकोदुबलेपनकाशिकारहोनापड़ताहै।अगरआपकेसाथभीयेसमस्याहैतोआपकोटेंशनलेनेकीबिल्कुलभीजरुरतनहींहैंक्यूंकिगोंदऔरइलायचीसेअबजोहमआपकोजोउपायबतानेजारहेहैंइसकीमददसेआपकोभूखभीलगेगीऔरआपकावजनभीबढ़ेगा।तोआइयेजानतेहैंकिकिसतरीकेसेगोंदऔरइलायचीकासेवनकरकेभूखऔरमोटापाबड़ासकतेंहैं सबसेपहलेबाजारसेअश्वगंधाऔरशतावरीलेआयें।अबदोनोंऔषधियोंकोमहीनपीसकरपाउडरबनालें।तैयारपाउडरकोकांचकेडिब्बेमेंभरकररखलें।तैयारमिश्रणकोप्रतिदिनसुबह-शामभोजनकरनेकेएकघंटेबादगर्मदूधकेसाथतैयारकियेगएपाउडरकोएकचमचकिमात्रामेंलेकरइसकासेवनकरनाहै।इसउपायकोकरनेसेआपकुछहीदिनोंमेंनिश्चितरूपसेमोटेहोजायेंगे 6.

आगे की

क्या गुड़ खाने से कोलेस्ट्रॉल बढ़ता है

जीहांइसकेलिएअगरआपकिसीपार्कमेंनहींजासकते,तोअपनीकॉलोनीयाअपनेघरकेगार्डनमेंभीवाककरसकतेहै.

आगे की

सीना दर्द का घरेलू इलाज

यहमेटाबॉलिज्मकोबढ़ाकरशरीरमेंइकट्ठाहुईअतिरिक्तचर्बीकोगलानेमेंभीसहायकहै. आंवलाकासेवनकरनेसेशरीरकीरोग-प्रतिरोधकक्षमतामजबूतहोतीहै.

आगे की

लो ब्लड प्रेशर का होम्योपैथिक इलाज

हृदयपरDeriphyllinकेसाइडइफेक्टदिखाईदेसकतेहैं अगरआपकोइनमेंसेकोईभीरोगहैतो,Deriphyllinकोनलेंक्योंकिइससेआपकीस्थितिऔरबिगड़सकतीहै।अगरआपकेडॉक्टरउचितसमझेंतोआपइनरोगसेग्रसितहोनेकेबावजूदDeriphyllinलेसकतेहैं- क्याDeriphyllinकाउपयोगस्तनपानकरनेवालीमहिलाओंकेलिएठीकहै.

आगे की

रक्त की संरचना

जाहीरहैभूखकमहोनेसेआपकापेटऔरकमरनियंत्रितरहेगा.

आगे की

ऑपरेशन कराने के बाद क्या खाना चाहिए

कुछभीवजनकमकरनाबिल्कुलवजनकमनहोनेसेबेहतरहै.

आगे की

कोलेस्ट्रॉल संरचना

इसकासेवनकरनेसेकईतरहकीबीमारियोंकोठीककरनेमेंमददमिलतीहै.

आगे की

लो ब्लड प्रेशर डाइट इन हिंदी पीडीएफ

इसकेअलावाअश्वगंधासेपेटसंबंधीरोग,ल्यूकोरिया,गठिया,सेक्सुअलप्रॉब्लम्सऔरबल्डसंबंधीदिक्कतेंभीदूरहोतीहै.

आगे की

हीमोग्लोबिन को कैसे बढ़ाएं

नाश्तेमेंनमकीनदलियायाअंडाखानाआपकोपतलाहोनेमेंमददकरेगा.

आगे की

ब्लड प्रेशर का घरेलू उपाय

नोट:कोईभीउपायअपनानेसेपहलेडॉक्टर्सकीसलाहजरूरलें) डिनरबहुतहीआरामसेखानेकीआदतहोनीचाहिए,बल्किअगरआपवजनघटानेकालक्ष्यरखरहेहैंतोआपकोअपनेखानेकोबहुतधीरे-धीरेचबानाचाहिए.

आगे की

एबीपी न्यूज़ वीडियो

सोयाबीनमेंफ़ायटोएस्टोजीन्सहोतेहैंजोशरीरमेंटेस्टोस्टरोनकालेविलकमकरतेहैं।रोज30ग्रामसोयाबीनकेबीजगलाकरखानालाभदायकउपचारहै इसक्षणभंगुरसंसारमेंपरमात्माकीअनन्यभक्तिसेबड़ाअन्यकुछभीनहींहै।मोक्षकोभीइसकेआगेहीनबतायागयाहै दालचीनीमेंएंटीएजिंगतत्वउपस्थितहोतेहैं।एकनीबूकेरसमेंदोबड़ेचम्मचजैतूनकातेल,एककपचीनी,आधाकपदूध,दोचम्मचदालचीनीपाउडरमिलाकरपाँचमिनटकेलिएशरीरपरलगाएं।इसकेबादनहालें,त्वचाखिलउठेगी फालिज-लकवेकाप्रकोपजिनअंगोंपरहो,उनअंगोंपरजायफलकोपानीमेंघिसकररोजलेपकरनाचाहिए।दोमाहतकऐसाकरनेसे,अंगोंमेंजानआजानेकीसंभावनादेखीगयीहै तीनोंवेदोंमेंकहेहुएसकामकर्म-अनुष्ठानकोकरनेवालेऔरसोमरसकोपीनेवालेजोपापरहितमनुष्ययज्ञोंकेद्वारा,इंद्ररूपसेमेरापूजनकरकेस्वर्गप्राप्तिकीप्रार्थनाकरतेहैं,वेपुण्योंकेफलस्वरूपपवित्रइन्द्रलोककोप्राप्तकरके,वहाँस्वर्गकेदेवताओंकेदिव्यभोगोंकोभोगतेहैं जायफलपाउडरदूधमेंमिलाकरलेनेसेसर्दीकाअसरठीकहोजाताहै स्त्रियोवैश्यास्तथाशूद्रास्तेऽपियान्तिपरांगतिम्॥9.

जबकिएल्कोहॉलसेदोसमस्याएंपैदाहोतीहै,एकतोइसमेंहाईकैलोरीहोतीहैऔरकमपोषकतत्व.

आगे की

उच्च रक्तचाप आप ऊपर नहीं है

पढ़िएकौन-कौनसेफायदेहैंहरदिननींबू-शहदकारसपीनेसे. 3करोड़लोगयानीहरपांचवांभारतीयवजनसंबंधीबीमारीसेपीड़ितहै जिसकीबॉडीमेंमसल्समासअधिकहोगावोअधिककैलोरीबर्नकरेगाउसकीअपेक्षाजिसकीबॉडीमेंअधिकफैटहै उदाहरणकेलिए,कमइंटेंसिटीवालेएरोबिकएक्टिविटी(5MET)सेहाईइंटेंसिटीवालेएरोबिकएक्टिविटी(7MET)कीतुलनामेंप्रतिमिनटकमकैलोरीबर्नहोतीहै।वहींधीमीगतिसेचलनेपर(3MET)याऔरभीकमकैलोरीबर्नहोतीहै யெகோவா.

आगे की

शिशु के मस्तिष्क का वजन कितना होता है

तोउससेहमारेशरीरमेंवजनकमनहींहोताहै? यहएकमौलिकचिकित्सासिद्धांतहै.

आगे की

निम्न घनत्व वसा कोलेस्ट्रौल

पर्याप्तमात्रामेंपानीपीनेसेमेटाबोलिज़्मसहीरहताहैऔरशरीरसेToxinनिकलतेरहतेहैं.

आगे की

वीएलडीएल रेंज वीएलडीएल कोलेस्ट्रॉल का स्तर चार्ट

प्रेग्नेंसीमेंकौनसे5ड्रिंकपीनेसेअबॉर्शनकेचांसबढ़तेहैं,जाननेकेलिएक्लिककरेंआखिरीस्लाइडपर. सेबकासिरकाउनचीजोंमेंशामिलहैंजिनकासेवनकरतेवक्तकुछसावधानियांबरतीजातीहैं.

आगे की

भारत में ट्रोपोनिन टेस्ट किट की कीमत

8ग्रामफाइबर,3. दिल्लीपुलिससेअपीलहैकिइसजैसेगुस्ताखकोसलाखोंकेपीछेभेजे.

आगे की

मेधा वटी फॉर एंग्जायटी

वित्तीयसमावेशकोबढ़ावादेनेवालीइसयोजनाकेतहतछहजनवरीतकजनधनखातोंकीकुलसंख्या41? अबइसे10मिनटतकउबालें.

आगे की

नदी की परिभाषा

मोटापासभीमेंअलगअलगकारणसेहोताहैहरकिसीकामोटापाबढ़नेकाकारणअलगहोताहैउसीकेहिसाबसेडाइटप्लानदियाजाताहै आजकेदौरमेंहमाराखानपानसहीनहोनेकेकारणहमारामोटापाबढ़ताजारहाहैऔरमोटापाबढ़नेकीवजहसेहीहमाराशरीरअनेकोबीमारियोंकाशिकारहोताजारहाहैऔरमोटापाबढ़नेकीवजहसेइसकाअसरहमारीपर्सनैलिटीपरपड़ताहैवहीमोटापेकीकीवजहसेहमारालाइफस्टाइलभीबिगड़ताजाहैलोगअपनावजनकमकरनेकेलिएनजानेक्याकुछकरतेहैलेकिनफिरभीउन्हेंइसकारिजल्टनहींमिलपाताहैवोवजनकमकरनेकेलिएडाइटिंग,एक्सरसाइज,रनिंग,सप्लीमेंटेशनहरएकतरीकाअपनातेहैपरफिरभीउन्हेंजैसावोचाहतेहैवैसारिजल्टनहींमिलपातायारिजल्टमिलताभीहैतोसिर्फखुशसमयकेलिएहीमिलताहैजिसकेकारणफिरवोडिमोटिवेटहोजातेहैकुछलोगतोइसकेलिएखाना-पीनातकछोड़देतेहैं।परंतुशायदवोलोगयेनहींजानतेकिखाना-पीनाछोड़नेसेवजनकमनहींहोता।बल्किवोऔरबीमारियोंकाशिकारहोजातेहैऔरउनकेचहेरेकीरौनकभीगायबहोजातीहैजिसकीवजहसेउनकाकॉफिडेंसभीकमहोजाताहैजिसकारणवोअपनेआपकोऔरसेकमसमझतेहैअगरआपभीअपनेबढ़तेवजनसेपरेशानहैऔरआपनेभीअपनावजनकमकरनेकेलिएहरएकतरीकाअपनालियाहैजैसेarticle,videoदेखकरउनकेकहेविचारोपरचलकरसबकुछकरलियाहैपरआपकोइसकाकुछरिजल्टनहींमिलाहैयेसबलिखकरमैंआपकीपरेशानीकोऔरनहींबढ़ारहाहूं,बल्किआपभीअगरवेटकमकरनाचाहरहेहैं,तोउसकेबारेमेंबसकुछबेसिकचीजेंबतारहाहूं।औरबेसिकचीज़ोकेसाथसाथमेंआपकोएकऐसीtherapyकेबारेमेंबताऊंगाऔरयेtherapyएकनेचुरलऔरआयुर्वेदिकहैऔरयेtherapyकरवाकरआप9दिनोंमें6किलोतकवजनकमकरसकतेहैतोआजमेंआपकोबताऊंगाकीमोटापाबढ़नेकाकारण,मोटापाकमकरनेकेलिएडाइट,औरमोटापाकमकरनेकेलिएtherapy.

टेलीविजनकार्यक्रमकिसीविज्ञापन,ट्रेलरयादर्शकोंकेलिएआकर्षणकेहेतुनहोनेवालीसामग्रीकेकिसीअन्यखंडकेअलावा,ओवर-द-एयर,केबलटेलीविजनयाइंटरनेटटेलीविजनपरप्रसारितकरनेकेलिएसम्बन्धितप्रस्तुतियोंकीएकशृंखलाहैं।शायदहीकभीयह.

आगे की

बहक का अर्थ

मोटापेसेअगरकोईव्यक्तिपरेशानहैतोउनकेलिएयहकाफीउपयोगीसाबितहोसकताहै.

आगे की

टीबी गोल्ड टेस्ट क्या है

इसतरहयेबालोंकीजड़ोंकोमजबूतकरताहैऔरबालझड़नेकीसमस्याकोदूरकरताहै!

आगे की

एसएमएस अस्पताल जयपुर में हार्ट डॉक्टर

बतादेंकिदिल्लीसरकारकेसंशोधितअनुमानकेतहतबीटीएकेतौरपरवित्तीयवर्ष-21केदौरानईडीएमसीको864.

आगे की

हाई ब्लड प्रेशर कंट्रोल करने के घरेलू उपाय

दोस्तोंयेपोस्टहमइसलिएलिखरहेहैक्यूंकिहमकोबहुतलोगपूछतेहैकीहुमारापेटबहुतज्यादाबहारनिकलाहुआहैजिससेहमकोबहुतपरेशानीहोतीहैऔरहमकोअपनेपेटकोसपाटकरनाहै. एकसहीकीटोआहारकार्बोहाइड्रेटऔरप्रोटीनकीजगहवसा(Fat)कीअधिकमात्रापरआधारितहोताहै।इसकाउद्देश्यहैवसासेअधिकसेअधिक90तककैलोरीनिकालना।डॉ.

आगे की

हृदय रोग मराठी माहिती

मेरेचेहरे,कंधे,कूल्हे,पेट,पैरोंमेंजमाफैटबताताथाकिअसलमेंमैंकिसहदतकखुदसेजंगकररहीथी. जैसेहीअजवाइनकापानीअच्छेसेउबलजाए,तबउसपानीकोअच्छेसेछानलीजियेऔरबचेअजवाइनकोअलगकरदीजिए.

आगे की

कोच्चि Biennale 2018 कलाकार सूची

पे-ऑन-डिलीवरीऑर्डरकेलिए,हमक्रेडिटकार्ड तथ्य:अगरआपकोअभीभीप्रेरणाकीजरूरतहैहो,मैंआपकेसाथएकसीक्रेटसाँझाकरतीहूं।मैंअपनीसातसालपुरानीजींसमेंबिनासांसथामेयापेटकोअंदरकियेबिनाआसानीसेफिटहोजातीहूं उबलेअंडेकोमक्खनयाचीनीरहितमेयोनीज़(Mayonnaise)केसाथमिलायाजासकताहै।आजसेहीब्रेड,अनाज(Cereals),कॉर्नफ्लेक्स(CornFlakes),पोहाऔरपरांठोंकोअलविदाकहदीजिये।कृपयाध्यानदेंकिआपकिसीभीतरहसेटमाटरकीसॉसऔरटमाटरमेंअधिकमात्रामेंचीनीहोतीहै जबआपअंडेपकारहेहैंतोइसेपकानेकेलिएघीयामक्खनसबसेअच्छामाध्यमहोगा,क्योंकिइनमेफैटअधिकमात्रामेंहै।मेरेअनुभवसेमुझेयहएहसासहुआकिपैनमेंमक्खनबहुतजल्दीपकताहै,तोयहएकअच्छाविचारहैकीबादमेंअंडोकेऊपरइसेलगालियाजाये।तीनसनीसाइडउपअंडे(Sunnysideup)चारस्लाइसबेकनकेसाथमेरापसंदीदानाश्ताहै।मैंएकदोस्तकोजानतीहूंजोपहलेएकमहीनेमेंलगभगछहअंडेतकखायाकरताथा।मैंनेपहलेहीआपकासवालसुनसकतीहूं!परेशाननहोंइससेकोलेस्ट्रॉलनहींबढ़ता।जिसदिनआपअपनेउत्कृष्टजीवनकोचुननेऔरKetoजीवनशैलीकोअपनानेकेकारणसंतुष्टिमहसूसकरतेहैंतोअपनेलिएएकचीजआमलेटबनायेजिसकेअंदरबेकन(bacon)भरेहों।अगलीबारीमैंनिश्चितरूपसेसाथइसकीतस्वीरसाँझाकरुँगी शुरुआतकरतेहैंदिनकेसबसेजरूरीआहारकेसाथ,सारादिनआपकोआवश्यकऊर्जाकेलिएएककीटोनाश्ते जबअपनेएकबारकीटोजेनिक(Ketogenic)आहारकोचुनलिया,तबआपकोहरवक़्तइसकेमंत्रकोयादरखनाहै.

आगे की

रकता शुधि आयुर्वेदेदेड मेडिस

2फीसदीबढ़कर25.

आगे की

धमनी तथा शिरा में अंतर स्पष्ट कीजिए

लेकिनक्याआपजानतेहैंकिसौंफवजनकमकरनेमेंयामोटापाघटानेमेंभीमददगारहै?जीहां,सौंफमेंकईऐसेपोषकतत्वहैंजोआपकीवजनकमकरनेऔरमोटापादूरकरनेमेंमददकरसकतेहैं. येमोटापेकेइलाजतैयारकरनेकेलिएनीबू,सेंधानमक,गर्मपानी,कालेचने,टमाटर,गाजर,मूली,अदरक,कालीमिर्च,औरधनियाइस्तेमालकियागयाहै.

आगे की

कार्डियोलॉजी का हिंदी अर्थ

अपनीage,weight,sexऔरactivitylevelsसेआपजानजायेंगेकिआपकोकितनीकैलोरीज(calories)चाहिए हमक्याचीजेंखाएंजिनसेहमअपनेकोFitरखसके अपनेनियमितकार्यकरनेकेलिएहमेंenergyकीजरूरतहोतीहैजोहमेंहमारेखान-पानसेमिलतीहै।यदिहमदिनभरसोतेभीरहेंगेतोभीहमारीbodyकोbodyकेdifferentprocessकेलिएभीenergyकीआवश्यकताहोतीहैजिससेहमारेअंगसहीतरहसेकामकरतेरहें।उसेहमBMRकहतेहैं हमआपसेएकचार्ट(chart)shareकररहेहैंजोआपकोactualcalorieneedsकेबारेमेंबताएंगेकिआपकेsex,weightandagegroupकेहिसाबसेकितनीकैलोरीज(calories)चाहिए शरीरकाएकहिस्साहैफैटीतोऐसेकरेंउसेपतला हरसालकीतरहयहसालभीबीतगयाऔरफिरशुरूहोगयानयासाल.

आगे की

सफी सिरप

त्रिफलाहरड़,बड़ेहा,आँवलाकीपरिभाषा! इसमेंजानेसेपहलेआपकोअपनायहांरजिस्ट्रेशनकरनाहोगा,जिसकाऑप्शनलॉगइनकेठीकनीचेदियाहुआहै.

आगे की

बप हाई के लक्षण बताओ

भारतीयफूड्समेंभीबहुतज्यादापोषणवालाआटा,फैट,सब्जीहोतेहैंजिसेआपअपनीकीटोडाइटमेंशामिलकरसकतेहैं.

आगे की

एक यूनिट में कितना खून होता है

क्योंकियहसभीमेहनतसेकामकरतेहैंऔरजबपूरीमेहनतकेसाथकामकियाजातातोहमारेशरीरकीकलोरीटूटतीरहतीहै जिसपानीमेंज्यादामोटापाहोताहैउसकोमोटापाकमकरनेकेलिएअपनीपानीपीनेकीक्षमताकोबढ़ानाचाहिएआपकोज्यादासेज्यादापानीपीनाचाहिएयदिआपकामननहींहैतोभीआपकोज्यादासेज्यादापानीपीनेकीकोशिशकरनीचाहिए.

आगे की

Binalewala रैप संस्करण एमपी 3 डाउनलोड

जिससेआपकाशरीरबहुतआकर्षकदिखनेलगेगा.

आगे की

इकोकार्डियोग्राफी का मतलब क्या होता है

सौंफपेटकीसभीसमस्याओंमेंफायदेमंदहोताहै।सौंफकापानीपीनेऔरसौंफखानेसेआपकोकब्ज,एसिडिटीऔरअपचकीसमस्यासेछुटकारामिलजाएगा।सौंफपाचनकीक्रियाकोतेजकरताहै।यहीकारणहैकिभारतमेंखानेकेबादसौंफखिलानेकीपरंपरारहीहै सौंफमेंआपकेदैनिकजरूरतका17विटामिनसी,7कैल्शियम,6आयरन,6मैग्नीशियम,3पोटैशियमऔर19मैंग्नीजहोताहै।इसमेंकैलोरीकीमात्राबहुतकमहोतीहै।इसकेअलावासौंफमेंऐसेएंटीऑक्सीडेंट्सहोतेहैं,जोशरीरकेमेटाबॉलिज्मकीप्रक्रियाकोतेजकरतेहैं।इससेआपकेशरीरमेंजमाहुईअतिरिक्तचर्बीतेजीसेघटतीहै सौंफमेंआयरनकीमात्राअच्छीहोतीहै।यहीकारणहैकिसौंफकेपानीकानियमितसेवनकरनेसेआपकेशरीरमेंहीमोग्लोबिनबढ़ताहै।एनीमिया(खूनकीकमी)केरोगियोंकेलिएसौंफखानाऔरइसकापानीपीनाफायदेमंदहोसकताहै आमतौरपरसौंफआपकेघरमेंमिलजातीहै.

आगे की

दवा के साइड इफेक्ट के लक्षण

Description. ख़ासतौरसेयेहमारेपेटकीचर्बीकोकमकरकेपेटअंदरकरताहैं.

आगे की

आंखों पर सफेद दाग

क्योंकिग्रीनटीमेंऐसेकईकेमिकलहोतेहैंजोदवाओंकेइफेक्टकोकमकरसकतेहैं.

आगे की

बीपी लो का घरेलू उपाय

याअपनेखानेकोकंट्रोलकरतेहैं. कंक्रीटवाटरटैंक-दरारोंकेगठनकेकारणयेपानीकेटैंकसतहकेमाध्यमसेरिसावकाकारणबनतेहैं!

आगे की

ट्राइग्लिसराइड टेस्ट क्या है

घरकाबनाखानाहीसबसेपौष्टिकऔरफायदेमंदहोताहै. बहुतज्यादाआमखानाभीस्वास्थ्यकेलिएहानिकारकसाबितहोसकताहै.

आगे की

बप का देसी इलाज इन हिंदी

जिनलोगोंकोभूखज्यादालगतीहैउन्हेंकमकैलोरीवअधिकफाइबरयुक्तफलऔरसलादखानाचाहिएजैसे-तरबूज,खीरा,पपीता,संतरा,अमरूदआदि.

आगे की

रक्त क्या है इसकी संरचना का वर्णन करें

पपीताकासेवनआपकोरोजानाकरनाचाहिएयहमोटापाकमकरनेमेंकाफीअच्छाघरेलूउपायमानाजाताहै. जैसेजैसेफास्टफूडआउटलेट्सबढ़रहेहैंवैसेवैसेहीमोटापाभीलोगोंमेंबढ़रहाहै.

आगे की

शरीर की सबसे छोटी रक्त वाहिनी कौन है

ताजाखजूरबहुतसॉफ्टहोताहै,जोआसानीसेपचजाताहै,इसमेंग्लूकोसभीहोताहै,जिसेखानेकेबादशरीरमेंताजगीआतीहै. मुख्यरूपसेइसकाइस्तेमालमसालेकेतौरपरखानेकास्वादबढ़ानेकेलिएकियाजाताहै!

आगे की

रक्त का थक्का जमने में सहायक तत्व

शरीरमेंसुस्तीहोजातीहै!

आगे की

टेस्ट फॉर हार्ट अटैक

वजनघटानेकेलिएएक्सपर्ट्स7खासतरीकोंपरज्यादाजोरदेतेहैं. हल्दीमेंकरक्यूमिननामकरसायनपायाजाताहैजोदवाकेरूपमेंकामकरताहै.

आगे की

शरीर में लगभग कितना खून होता है

कमयाज्यादालेनेपरशरीरकावेटकमयाबढ़जाताहै कालेवलबहुतबढ़ाहै।जिससेहार्मोनऔरमस्तिष्ककीकार्यकुशलतापरबुराअसरहुआहै।जिससेशरीरकीसभीगतिविधियोंकीकार्यकरनेकीक्षमतामेकमीआईहैअबचाहेवोकैलोरीकाखर्च(बर्न)करनाहीक्योंनाहो| कीसभीबातोंकोविस्तारसेसमझनेकेलिएनिम्नलिखितबातोंपरफ़ोकसकरनेकीकोशिशकरेंगे| मेलंचकामेनूहरदिनबदल-बदलकैलोरीकोstableरखकरWeightlossकरनेकेलिएउपयोगकरसकतेहै हरव्यक्तिकीदिनभरकेकार्यकाप्रारूपऔरकार्यकरनेकावातावरणअलग-अलगहोताहै।कमफिजिकलactivityऔरआरामदायकworkingenvirnomentकीस्थितिमेकमकैलोरीबर्नहोगीऔरज्यादाफिजिकलactivityऔरHardworkingconditionमेअपेक्षाअपेक्षाकृतज्यादाकैलोरीबर्न(खर्च)होगी|इसेएकउदाहरणसेसमझतेहै केलिएज़रूरफॉलोकरेंगे| एकMultinationalcompanyमेंकामकरनेवालेHRemployeeकेकामकरनेमेकमकैलोरीखर्चहोगीअगरहमउसकीतुलनाएकसड़कनिर्माणकेकार्यमेलगेमजदुरसेकरे|जहां8घंटेकेकाममेHRemployeeकोसिर्फ1800कैलोरीऊर्जाकीजरूरतहोगीवहींमजदूरको3500कैलोरीकेआवश्यकताहोगी|तोफिरआपइसउदाहरणसमझगयेहोंगेकीMotapakamkarnekeliyedietकेसाथआपकोअपनीPhysicalactivityपरभीफ़ोकसकरनाहोगा| को350से400औरपुरूषोंको400से450कैलोरीकाभोजनदिनके12से1बजेकेबीचलेलेनाचाहिएहै हमजोभीभोजनयापेयप्रदार्थलेतेहैउनसेहमारेशरीरकोऊर्जामिलतीहै।इसऊर्जाकोमापनेकीईकाईकैलोरी(Calorie)है।शरीरकोयेकैलोरीचाररूपोंमेंप्राप्तहोतीहै हैफिरभीवजननहींबढ़ताहै।इसकीमुख्यवजहहरशरीरकाBMRअलग-अलगहोनाहै।BMRहीपाचनतंत्रकीसक्रियतातयकरताहै।पाचनतंत्रसक्रीयतोहरप्रकारकेCaloreiकाबर्न(खर्च)होजाताहै।औरफैटशरीरमेजमानहींहोता|इसकेठीकविपरीतअगरपाचनतंत्रकमसक्रीयतोशरीरमेफैटजल्दीएक्स्ट्राचर्बीऔरमोटापेकारूपलेकरवजनबढ़ादेताहै करनेमेंसफ़लहोसकतेहै विटामिनऔरमिनरल्सहड्डियोंकोमजबूत,घावोंकोठीककरनेऔरशरीरकीरोग़-प्रतिरोधकक्षमता(immunesystem)कोबढ़ानेमेंमददकरतेहै।भोजनकोऊर्जामेंभीबदलतेहै।औरकोशिकाओंकीमरम्मतकरतेहै मेंआपकेस्वादकोध्यानमेरखतेहुएलेखतैयारकियाहै केअसरसभीलोगोंमेएकसमाननहींहोताहै।क्योंकिसभीकाBMIऔरBMRअलग-अलगहोताहै।जिसकीहमनेइसलेखमेविस्तारसेचर्चाकीथी| बहुतबेहतरीनजानकारीआपनेसाझाकीहै,keepitonregularupdates!!.

आगे की

लाल पेशी वाढवण्यासाठी उपाय

येआर्टिकलDailyoवेबसाइटकेलिएSovenTrehanनेलिखाथा! बहुतसीस्टडीजमेंयहबातसाबितहोचुकीहैकिसोनेसेठीकपहलेअगरआपमोबाइलफोनयाअन्यगैजेट्सकाइस्तेमालकरतेहैंतोइनसेनिकलनेवालीब्लूलाइट(BlueLight)स्लीपहॉर्मोनमेलाटोनिनकाउत्पादनकमकरदेतीहै.

आगे की

मानव शरीर में सबसे बड़ी हड्डी का क्या नाम है

जिसकेलिएबाजारोंमेंतरह-तरहकीदवाइयां,स्पलिमेंटभीमौजूदहैं. जरूरीहैकिप्रोटीन,कार्बोहाइड्रेटऔरफैट्सकीमात्राबराबरहो.

आगे की

सामान्य गैर एचडीएल कोलेस्ट्रॉल का स्तर ब्रिटेन

उबलेहुएपानीमेंसमानमात्रामेंदालचीनीऔरशहदडालकरइसेअच्छीतरहमिलालें. आपएडच्वाइसेसवालेबटनपरक्लिककरकेअपनीपसंदबदलसकतेहैं.

आगे की

सिराजुद्दौला का शासनकाल

आजकलकेजीवनसेलीकेअनुसारमोटापाबढ़नाएकआमबातहोगईहै।व्यक्तिकाबिज़िschdeludedलोगोकोअपनेऊपरध्यानदेनेनहींदेता।सुबहलेटतकसोना,ऑफिसमेंबैठकरलैपटापकेसामनेकामकरतेरहना,भुखलगेतोफास्टफूडखालेना,रातको. योगकेइनआसनोंकीमददसेआपबिनाकिसीसाइडइफेक्टकेअपनावजनघटासकतेहैं.

आगे की

दूध में किसकी मात्रा सबसे कम होती है?

7-3.

आगे की

क्या करेगा भाई

बहारकेफ़ास्टफ़ूडमैंकेवलफैटहोताहैजिससेहमारावजनबढ़ताहैहमेपोशाकतत्त्वनहींमिलतेहै.

आगे की

हिंदी में हल्के कार्डोमेगाली

आपकीमूवमैंटकोस्मूथबनाएरखनेवालाचिपचिपाद्रव्यपदार्थभीकमहोजाताहै. टेलीविजनकार्यक्रमकिसीविज्ञापन,ट्रेलरयादर्शकोंकेलिएआकर्षणकेहेतुनहोनेवालीसामग्रीकेकिसीअन्यखंडकेअलावा,ओवर-द-एयर,केबलटेलीविजनयाइंटरनेटटेलीविजनपरप्रसारितकरनेकेलिएसम्बन्धितप्रस्तुतियोंकीएकशृंखलाहैं।शायदहीकभीयह.

आगे की

होम्योपैथिक मेडिसिन फॉर हाई ब्लड प्रेशर इन हिंदी

विशेषज्ञोंकाकहनाहैकिशरीरकेसौंदर्यकोबनाएरखनेकेलिएजरूरीहैकिभरपूरपानीकासेवनकियाजाए।अच्छातो?

आगे की

ब्लड प्रेशर लो होने के लक्षण बताइये

इलायचीकेदानोंकोपीसकरपाउडरबनालेंऔरउसेअपनीदूध,चाययाखानेमेंप्रयोगकरें. इसकेलिएसबसेपहलेमोटापाकमकरनाजरूरीहै.

आगे की

हिंदी में गैर एचडीएल कोलेस्ट्रॉल

लेकिनइसमेंखानेकास्वादबढ़ानेकेसाथ-साथकईअन्यगुणभीहोतेहैं. बच्चेकोहोगयीहैसर्दी-खांसी,तोउसेइन4फूड्ससेरखेंबिल्कुलदूर एस्ट्रोजनकेघटतेस्तर(जिससेउसीअनुपातमेंटेस्टोस्टेरोनकाप्रभावबढ़जाताहै)सेशरीरमेंफैटकेवितरणपरअसरपड़ताहै।इसकेकारणपेटमेंफैटकाजमावहोनेलगताहै।मांसपेशियोंमेंकमीआनेपरउसीअनुपातमेंफैटमेंवृद्धिहोनेलगतीहै उच्चरक्तचापऔरइंसुलिनरेजिस्टेंसकाजोखिमबढ़जाताहै धीरे-धीरेवजनकमकरनेकीकोशिशकरेंऔरइनकोशिशोंकोलगातारजारीरखें डॉ.

आगे की

फिजिशियन म्हणजे काय

जिनमेंसेवेटलॉसमेनहै. अपनेवजनकोकंट्रोलकरनेकेलिएलोगनाजानेक्याक्याकोशिशकरतेहैं!

आगे की

छाती में कफ जमने का घरेलू उपाय

बढ़तेवजनकोकंट्रोल(WeightLoss)करनेकेलिएहेल्दीब्रेकफास्टडाइट(HealthyBreakfastDiet)बहुतजरूरीहै.

आगे की

हिंदी में रक्तचाप की परिभाषा

लोगकीटोजेनिकडाइटकेकामयाबहोनेकीगारंटीलेतेहैं,वजनमेंकमीकेअलावाइसकेकईस्वास्थ्यफायदेहैं. 5सेकमहोताहै।अगरआपकाबीऍमआई(BMI)18.

आगे की

परिधि का अर्थ इन इंग्लिश

रातकेवक्त7से8घंटेकीपर्याप्तनींदलें. चीनी,गुड़,शहद,मिठाई,केक,पस्ट्रीमेंऊर्जा(कैलोरी)कीमात्राबहुतहोतीहै,सोयदिआपकोमीठाखानेकामनहोतोफलखानेकीआदतडालें डाइटिंगएकऐसीचीज़हैजोलंबेसमयतककायारखनेमेंकोईभीव्यक्तिअसफलहोताहै।वास्तवमें,जोलोग"डाइटिंग"करतेभीहैंउनकाएकसमयकेबादवजनअधिकबढ़जाताहै।वज़नकमकरनेपरध्यानकेंद्रितकरनेकेबजाय,अपनेशरीरकोस्वस्थभोजनऔरपोषकतत्वोंसेपोषितकरनेकीकोशिशकरें औरवजनकमकरनेकेलिएहीनहीं,अच्छेस्वास्थ्यकेलिएभीसर्वश्रेष्ठहैयोग।यहनकेवलमांसपेशियोंमेंमजबूतीलाताहै,बल्किपाचनक्रियाकोभीबेहतरबनाताहै।तोयोगकोअपनाएंऔरवजनघटाएं आजकलगैजेट्सहमारेदिनचर्याकेहरकार्यमेंशामिलहोगयाहै,कोशिशकरेंकीभोजनकरतेसमयअपनेमोबाइल,टेबलेट,लैपटॉपकोदूररखकरयाबंदकरकरखानाखाएं,गैजेट्सकेसाथखानाखातेसमयभोजनकीमात्रापरध्याननहींदेपातेजिससेओवरईटिंग(ज्यादाखाने)केआसारकाफीबढ़जातेहै.

आगे की

गेहूं में कौन सा प्रोटीन पाया जाता है

आजहमआपकोऐसेकुछउपायबताएंगेजोमोटापाकमकरनेनेबेहदमददगारसाबितहोतेहैं.

आगे की

बच्चे की धड़कन कितनी होनी चाहिए

सौंफमेंमूत्रवर्धकगुणहैंइसलिएसौंफकीचायपीनेसेशरीरसेविषाक्तपदार्थोंकोहटानेमेंमददमिलतीहै,जोबदलेमेंवजनकमकरनेमेंयोगदानदेताहै!

आगे की

तैलीय ग्रंथि

इसकेअलावापेटमेंगैसयाशरीरमेंपानीकीवजहसेसूजनआनेपरभीमोटापाबढ़ताहै. परहमसभीकेदिमाग़मैंपहलाप्रश्नआताहैं,फिरक्यूँहमइसेदशकोसेखारहेंहैं!

आगे की

ल्वेफ इन हिंदी

मुँहसेबदबूआनेपरदालचीनीकाछोटाटुकड़ाचूसें।यहएकअच्छीमाउथफ्रेशनरभीहै आसुरी-दुष्टप्रवृतिवालेव्यक्तिस्वर्ग-सुखकीप्राप्ति,कामनाओंकीपूर्तिकेहेतुउद्यमकरतेहैं।वेभगवान्सेविमुखहोतेहैं।उनकासत्कर्मोंसेकोईभीलगावनहींहोता।वेयदिऐसासोचेंकिउन्हेंपरमात्माकीप्राप्तिहोजाएगीतो,यहमृगतृष्णा,छलावा,स्वयंकोधोखादेनाहीहै।उनकेद्वाराकियेगएयज्ञ,दान,सकामकर्मउन्हेंभलेहीउच्चलोकोंतकलेजाएँ,मगरवहाँसेउन्हेंनीचेगिरनाहीपड़ताहै।वेजन्म-मरणकीशृंखलासेबँधेहीरहतेहैं।केवलशास्त्रोक्तसत्-सात्विककर्महीआत्माकोपरमात्मामेंलीनकरतेहैं।निष्काम-सत्कर्मजोप्रभुकोअर्पितकरदियागयाहो,वोनिष्फलनहींहोता।विभिन्नप्रकारकीविद्याएँ,ज्ञानअविष्कारऐसेलोगोंकोपरमात्मप्राप्तिकरवाहीनहींसकते।वैसेदेखाजायेतोयेलोगखुदहीमोक्षकेइच्छुकनहींहोते।खाना-पीना,मौज-मस्ती,यहीउनकाध्येय-मंतव्यहोताहै,जोउन्हेंपतन-अधोगतिप्रदानकरतेहैं।उन्हेंइसबातकाभीज्ञाननहींहैकिमोक्षक्याहै,किसलिएहै,इसकाप्रयोजनक्याहै,किसप्रकारमिलताहै!?उन्हेंसार-निस्सार,मुक्ति-बन्धनसेकोईसरोकारनहींहै।अपनेस्वार्थकीसिद्धिकेलिएऐसेलोगझूँठ,कपट,बेईमानी,कुकर्म-दुष्कर्म,हत्यायाअन्यकुछभीकरनेकोतत्पररहतेहैं।उनकास्वभावआसुरी,राक्षसी,मोहिनीप्रवृति-प्रकतिवालाहै।उनकोबारम्बारनर्कोंकीयातनाभोगनेकेबादकृमि,कीट-पतंगे,पशु-पक्षी,सरीसृपआदियोनियोंसेगुजरनापड़ताहैऔरजबकभीभीमनुष्ययोनिकोप्राप्तहोतेहै,वेपुनःउन्हींनिकृष्टकर्मोंमेंलिप्तहोजातेहैं प्रसवकेबादअगरकमरदर्दनहींख़त्महोरहाहैतोजायफलपानीमेंघिसकरकमरपेसुबहशामलगाएं,एकसप्ताहमेंहीदर्दठीकहोजाएगा बारीकपिसीकालीमिर्च,मुलहठीऔरमिश्रीकोशहदकेसाथमिलाकरखानेसेगलेकीतकलीफमेंलाभहोताहैतथाआवाजभीसाफहोतीहै श्वाससम्बन्धीरोग,खाँसीमेंइसकाचूर्णगुड़मेंमिलाकरचाटनेसेआराममिलताहै सकामभावसेदेवताओंकापूजनकरनेवालेशरीरछोड़करदेवताओंकोप्राप्तहोतेहैं।पितरोंकापूजनकरनेवालेपितरोंकोप्राप्तहोतेहैं।भूत-प्रेतोंकापूजनकरनेवालेभूतप्रेतोंकोप्राप्तहोतेहैं।परन्तुमेरापूजनकरनेवालेमुझेहीप्राप्तहोतेहैं 1).

आगे की

वैस्कुलर मीनिंग इन हिंदी

लोगोंनेवर्षोंइसकाइस्तेमालपकवानऔरइलाजमेंकियाहै.

आगे की

गणपति बप्पा डीजे सॉन्ग

परनिर्भरकरताहै।बी. अबWHOकेहिसाबसेअगरआपकाBMI25से30है,तोआपकाकहलातेहैंओवरवेट.

आगे की

पतञ्जलि दिव्या वती प्राइस

अगरआपवाकईवजनकमकरनाचाहतेहैंतोछोटीप्लेटमेंखानाखाएं,एकसाथकमखानालेंगेतोआपकमहीखाएंगे 5. छोटी-छोटीबातोंकोआपनजरअंदाजकरनासीखें.

आगे की

TAGALOG में ट्राइग्लिसराइड्स का अर्थ है

सफेदचीनीकोमीठाज़हरभीमानाजाताहैं.

आगे की

डायस्टोलिक पायदान

दूधसेबनीचीजें,मीठाईयोंऔरबासीखादपदार्थोंसेपरहेजकरें जल्दीसोनाऔरउठनाअच्छीलाइफस्टाइलकीनिशानीहै।आयुर्वेदकेअनुसारहमें9-10बजेतकसोजानाचाहियेऔरसुबह4-6केबीचउठजानाचाहिये।HealthlineडॉटकॉमकेअनुसारखराबSleephabitsकेकारणशरीरमेंकईऐसेहार्मोनरीलीसहोतेहैंजोमोटापेकाकारणबनतेहैं।इसलिएअपनेजागनेऔरसोनेकासमयफिक्सरखेंऔरजल्दीसोनेतथाजागनेकीआदतडालें 1.

आगे की

रक्त वाहिका क्या होती है

नक्सलप्रभावितऔरनॉर्थईस्टकेराज्योंमेंइंसेंटिवकीअधिकतमसीमा15हजाररुपएप्रतिमाहतकहै.

आगे की

Xanthelasma होम्योपैथी चिकित्सा का नाम

चूना,घीऔरशहदको,लेसमभागमिलाय 2. लेकिनजोलोगदिनभरअपनेशरीरसेअधिककामलेतेहैंयाअधिकशारीरकमेहनतकरतेहैं,उन्हेंकमसेकम12रोटियोंकीजरूरतहोतीहै.

आगे की

नार्मल ब्लड प्रेशर कितना होना चाहिए

क्यूँकीइनमेंकैलोरीकाफ़ीहोतीहैंतोइन्हेअपनेमुख्यभोजनमेखानाचाहिएं,जिससेआपकोलंबेसमयतकभूखनालगेऔरस्नॅकिंगसेबचो. Whenonedrinksateaspoonofturmericmixedinaglassofwarmmilkhefeelsbetter.

आगे की

बीपी कैसे करें

इसीलिएनकमरपतलीकरनेकेलिएनथोड़ाथोड़ाखातेंरहें,दिनमैं6बारखाएँ,मतलबहर3घंटोमैंकुछखाएँ,जोकभीज़्यादाभूखहीनालगे. पर्याप्तमात्रामेंपानीपीनेसेमेटाबोलिज़्मसहीरहताहैऔरशरीरसेToxinनिकलतेरहतेहैं.

आगे की

हिंदी में रक्तचाप क्या है

Thecostofbrokencomponentswillbecoveredbythebuyer,butduringguaranteeperiod,thecostofbrokencomponentswillbecoveredbytheseller,excepttheeasybrokenpartsanddamagedpartsbyhumanreasons! नईदिल्ली:कांग्रेसकेवरिष्ठनेताअहमदपटेलकेनिधनपरप्रधानमंत्रीनरेंद्रमोदीनेउन्हेंश्रद्धांजलिदीहै.

आगे की

लो ब्लड प्रेशर के लक्षण क्या है

वजनकोजल्दसेजल्दकमकरनाचाहतेहैंतोसबसेजरूरीहैअपनीडाइटकाध्यानरखना।अपनीडाइटमेंअगरआपअदरक. इसइश्यूकाप्राइसबैंड483से486रुपएप्रतिशेयरतयकियागयाहै.

आगे की

उच्च रक्तचाप के लिए आयुर्वेदिक दवा

इसकेसेवनसेकब्जऔरपेटसंबंधीसमस्याएंदूरहोतीहैं?

आगे की

मानवी शरीरात किती पेशी असतात

कृषि,खनन,बिजलीवितरण,परमाणुऊर्जा,स्पेस,डिफेंसआदिक्षेत्रोंमेंकईआर्थिकसुधारोंकीघोषणाकीगईहै?

आगे की

विट्रस

ऐसाआपदिनमें2-3बारकरसकतेहैं. त्रिफलाहरड़,बड़ेहा,आँवलाकीपरिभाषा.

आगे की

दुर्लभ रक्त वर्ग है

जीरेमें7कैलोरीहोतीहै.

आगे की

वृत्त का अर्थ

ठोसआहारकेसेवनसेशरीरसेल्फ-रेगुलेटकरसकताहै? इसेआपसुबहउठनेकेबादयारातमेंसोनेसेपहलेसेवनकरसकतेहैं.

आगे की

उत्तर के साथ लिपोप्रोटीन पर एमसीक्यू

ग्रा.

आगे की

माहवारी नहीं आने पर क्या करना चाहिए

पालकमेंआयरन,मैग्नेशियमऔरअन्यविटामिनपायेजातेहैं. स्किपिंगयानिकिरस्सीकूदनाभीएकअच्छीआदतहै वजनकमकरनेकेलिएक्यानहींखानाचाहिए-FoodstoAvoidObesityinHindi उबलाआलूखानेकेबादपेटजल्दीभरजाताहै,जिससेकुछऔरखानेकीइच्छानहींकरतीहै।इसलिएयहफैटलॉसडाइटमेंशामिलहै।हालांकि,इसबातकाध्यानरखेंकिउबलेआलूकोकभीफ्रेंचफ्राइज़याचिप्ससेरिप्लेसकरनेकीकोशिशनकरें अगरआपअपनावजनकमकरनेकेलिएसीरियसहैंतोअपनेलंचऔरडिनरमेंमसूरकीदालऔरराजमाकोशामिलकरें।इनमेंप्रोटीन,फाइबरवकुछस्टार्चपायाजाताहै।इनमेंफैटकीमात्राभीबेहदकमहोतीहै जिन्हेंतीखाखानापसंदनहींहै,वेइसविकल्पसेथोड़ाघबरासकतेहैंपरजोतीखाखानेकेशौकीनहैं,उनकेलिएलालमिर्चवजनकमकरनेकाउपाय(vajankamkarnekatarika)साबितहोसकतीहै।दरअसल,लालमिर्चमेंएकऐसातत्वपायाजाताहै,जिससेभूखकमलगतीहैऔरफैटभीबर्नहोताहै बहुतज्यादातनावमेंरहनेवालेलोगवडिप्रेशनकेशिकारमरीजभीमोटापेकाशिकारहोजातेहैं।दरअसल,दोनोंहीपरिस्थितियोंमेंहॉर्मोनलबदलावहोतेहैं,जिसकासीधाअसरव्यक्तिकेवजनपरपड़ताहै अपनीजीवनशैलीमेंज़रूरअपनाएंये5खासडाइटटिप्स 1.

आगे की

हाई बीपी को कैसे कंट्रोल किया जाए

यहआपकोडीटॉक्सिकेटकरेगाऔरदिनभरतरोताजाबनाएरखेगा. इसकीवजहसेशरीरमेंइंसुलिनऔरशुगरकीमात्राबढ़तीहै,जिससेकिरातमेंनींदनआनेकीभीसमस्याहोतीहै.

आगे की

आलिंद का हिन्दी अर्थ

नहीं,लेकिनफिरभीआपLinoleicAcidकोलेनेसेपहलेडॉक्टरसेजरूरपूछें लीवरकेलिएLinoleicAcidहानिकारकनहींहोती।आपइसेडॉक्टरकीसलाहकेबिनाभीलेसकतेहैं क्याLinoleicAcidकाउपयोगगर्भवतीमहिलाकेलिएठीकहै. विषय-विशेषज्ञोंकेदलहोंजहाँTollFreeनम्बर्सद्वाराकोईभीशिक्षार्थीसम्पर्ककरकेसम्बन्धितविशेषज्ञसेजिज्ञासा-समाधानकरासके!

आगे की

देवबंद पिन कोड

कानमेंदर्दहोनेपरअजवाइनकेतेलकीकुछबूंदेकानमेंडालनेसेआराममिलताहै.

आगे की

हिंदी में रक्तचाप आयुर्वेदिक चिकित्सा

योगकाअभ्यासकरतेसमयधीमेधीमेसांसभरेंऔरफिरछोड़ें.

आगे की

आँखों की कमजोरी के लक्षण

अहमदाबादकेमार्केटमेंगोल्डस्पॉट44,741रुपयेप्रतिदसग्रामपरबिका. आजहमआपकोबतातेहैंकिवोकौनसीआदतहैजिससेआपकामोटापाबढ़ताहै।औरआपकावजनतेज़ीकेसाथबढ़नेलगताहै।मोटापाहोनेकेएकनहींबल्किबहुतसेकारणहोतेहैं।.

आगे की

सबसे बड़ी बहिःस्रावी ग्रंथि

इसकेसाथहीएकताकपूरनेफिल्मकीपूरीकास्टऔरप्रोडक्शनटीमकोटैगकियाहै. 3630.

आगे की

छाती में दर्द का आयुर्वेदिक इलाज

इसस्टडीसेभीबेलीफैटघटानेमेंसमूजेअनाजकीभूमिकासाबितहुई.

आगे की

पूर्ण अवस्था में रक्त का निर्माण कहां होता है

इससेहरजनधनखाताधारककेद्वाराउपयोगऔरअनुकूलनकास्पष्टसंकेतदिखरहाहै.

आगे की

रक्त क्या है रक्त के कार्य बताइए

ऐलोवेराकाज्यूसमेटाबॉलिज्मकीप्रक्रियाकेसाथशरीरकोडिटॉक्सकरकेवेटलॉसकेप्रक्रियाकोबढ़ाताहै।इससेनासिर्फवजनकम.

आगे की

मनुष्य के हृदय का वजन क्या है

वहीं,वृषभराशिवालेलोगइससमयकिसीभीव्यक्तिविशेषपरबहुतविश्वासनकरें. एक्सपर्ट्सबतातेहैंकिहरदिनरातमेंभोजनसोनेसे3घंटेपहलेहीकरलेनाचाहिए.

आगे की

भैंस का घी खाने के नुकसान

त्रिफलाआयुर्वेदमेंबहुउपयोगीऔषधिहैपरम्परागतचिकित्सापद्धतिमेंत्रिफलाचूर्णकोअमृतसमानउपयोगीमानाहैयहत्रिदोषशामकऔषधिहैत्रिफलाकेगुणधर्म,निर्माणविधिएवंप्रयुक्तद्रव्योंकेआधापरत्रिफलाके. इसकेअलावायदिआपकोकब्जहैतोछोटीइलायचीकासेवनयाछोटीइलायचीकोपकाकरतैयारकिएगएपानीकासेवनआपकोफायदापहुंचाएगा.

आगे की

डॉपलर अर्थ

रातकेवक्त7से8घंटेकीपर्याप्तनींदलें.

आगे की

फुफ्फुसीय उच्च रक्तचाप उपचार

बांद्रा-कुर्लाकॉम्पलेक्स,बांद्रा(पूर्व),मुंबई-400051 सातवींमंजिल,आर!

आगे की

मनुष्य के हृदय की आंतरिक संरचना का चित्र

योगतथाइसकेफायदे. इसमेंविटामिनई,ए,सीऔरबी-कॉम्प्लैक्सजैसेविटामिनभीअधिकमात्रामेंपाएजातेहैं,येमेटाबोलिकसिस्टमकोदुरुस्तरखताहै.

आगे की

कोरोना के समाचार दिल्ली

उच्च कोलेस्ट्रॉल का स्तर चार्ट कनाडा जीरेकेपानीकेहैंबेजोड़फायदे,खालीपेटपीनेसेपासनहींआतीबिमारियां आदिपोषकतत्वपाएजातेहैं,जोशरीरमेंगुडफैटकोबरकराररखकर,बैटफैटकोबाहरनिकालनेमेंशरीरकीमददकरतेहैं।सरसोंकेतेलमेंपकाभोजनकरनेसेपेटसेजुड़ीपरेशानियोंकाभीबहुतकमसामनाकरनापड़ताहै पायाजाताहै।बॉडीमेंसेबैडफैटकोकमकरनेकेलिएगुडफैटकाहोनाबहुतजरुरीहै।ऐसेमेंअंकुरितअनाजआपकीबहुततरीकेसेसहायाताकरताहै मोटाहोनाकोईनहींचाहता,नचाहतेहुएभीनजानेलोगमोटापेकेशिकारकैसेहोजातेहैं?असलमेंकईबारअपनीडाइटमेंहेल्दीचीजेंतोऐडकरलेतेहैं,मगरवजनकोबैलेंसकरनेवालीचीजेंखानेमेंअक्सरहमनादानीकरबैठतेहैं।आजहमआपकोबताएंगेकुछऐसीआसानवस्तुएंजिन्हेंआपबहुतहीआसानीसेअपनीडाइटमेंशामिलकरकेखुदकोहेल्दीऔरपतलादोनोंरखसकतेहैं महसूसनहींहोता,जोआमआटेकीरोटीखानेकेबादअक्सरव्यक्तिमहसूसकरताहै।आयुर्वेदकेमुताबिकबाजरेकीरोटीखानेसेआपकावजनतेजीसेकमहोनेलगताहै हल्दीवालेपानीमें1चम्मचशहदमिलाकरपीसकतेहैं कोरोना के समाचार दिल्ली बहुतजल्दबर्नहोतीहै।पत्तागोभीफाइबरसेभरपूरसब्जीहै,जिसकेसेवनसेआपलंबेसमयतकखुदकोभराहुआमहसूसकरतेहैं।साथहीयहआपकेपेटकीसफाईकेलिएबहुतजरूरीभीहै कीपरेशानीहलहोतीहै वजनकमकरनेकेलिएअगरआपइलायचीकासेवनकरसकतेहैंतोपहलेइलाचयीकोक्रशकरलेंऔरउसेबीजोंसहितएकगिलासपानीमेंपूरीरातकेलिएभिगोकरछोड़दें।अगलेदिनसुबहउसपानीकोपीलें इलायचीकेगुणोंमेंबारेमेंजितनाभीकहाजाए,कमहीहै।कभीयहभोजनकास्वादबढ़ातीहैतोकभीमुंहकीदुर्गंधकोदूरकरतीहैं।इतनाहीनहीं,वजनकमकरनेमेभीइलायचीकाकोईजोड़नहींहै।दरअसल,इलायचीशरीरमेंफैटकोडिपॉजिटनहींहोनेदेता।साथहीइलायचीमेंभूखकमकरनेकाभीगुणहोताहैऔरइससेआपकेवेटलॉसप्रोग्रामकोबलमिलताहै।कईलोगोंमेंभूखनहोनेपरभीखुदभीखानेकीइच्छाहोतीहै।खासकरमीठाखानेकीललककोइलायचीखत्मकरदेतीहै।वजनकमकरनेकेलिएइलायचीकोआपइसतरहसेइस्तेमालकरसकतीहै- इलायचीकोजबमनकरेछिलकासहितखातेरहें।येपाचनकेसाथआपकेमुंहकेजायकेकोभीबनाएगाऔरशरीरमेंफाइबरभीपहुंचाएगा।जिससेवजनकमकरनेमेंसहायतामिलेगी अगरआपचाहेंतोइलायचीकोअपनीचायमेंभीइस्तेमालकरसकतेहैं।लेकिनअगरआपवजनकमकरनाचाहतेहैंतोइसचायमंेचीनीकाप्रयोगनकरें यदिआपकोपाचनसेजुड़ीसमस्यायाबदहजमीहैतोआपकोइलायचीकासेवनकरनाचाहिए।अपनेपाचनतंत्रकोमजबूतबनानेऔरडिटोक्सिफाईकरनेकेलिएवैकल्पिकरूपसेहररोज़सुबहइलायचीकीचायपीसकतेहैं।येआपकेपाचनतंत्रकेलिएलाभदायकहै मिलाएंऔररोजसुबहखालीपेटवरातकोसोनेसेपहलेपिएं मोटापाकमकरनेकेलियेआपलौकीकाजूसपीसकतेहैं।लौकीविटामिनसेभरपूरहोतीहै।इसमेंविटामिन-ए,विटामिन-सी,हाईफाइबरऔरआयरनहोताहै।जिसेवजनघटानेकेसबसेकारगरतत्वकेरूपमेंजानाजाताहै गर्भावस्थाकेबादपेटकोकमकरनेकेलिएदालचीनीऔरलौंगबहुतकारगारसाबितहोतेहैं ढूंढरहेहैंतोआपइसीवेबसाइटपरदेखसकतेहैं कासबसेअच्छातरीकाहैसंतुलितआहार(HealthyDiet)औरनियमितव्यायाम।वजनकमकरनेकेलिएव्यायामयाएक्सरसाइज(WeightLossExercise)केसाथहीवजनकमकरनेकेलिएभोजनयानीडाइटपरभीध्यानदेनाजरूरीहै कैटेचिनऔरकैफीनसेसमृद्धहोतीहै,जोमोटापाकमकरनेमेंमहत्वपूर्णभूमिकानिभातीहै आपभीमोटापेकोकमकरनेकेउपायढ़ूढ़रहेहैं.

केअन्यजोखिमकारकओबेजिटा120एमजीकैप्सूल(Obezita120MgCapsule)विटामिनA,E,Dऔरकेजैसेकुछविटामिनोंकेकठिनअवशोषणमेंशामिलहैं।इसीकारणसेचिकित्सकद्वाराखनिजऔरविटामिनकीखुराककीसिफारिशकीजासकतीहै ओबेजिटा120एमजीकैप्सूल(Obezita120MgCapsule)परिधीयअभिनयएंटीबेसिटीएजेंटोंसेसंबंधितहै।यहगैस्ट्रिकऔरअग्नाशयीलिपसकोअवरुद्धकरकेकामकरताहैइसप्रकारट्राइग्लिसराइड्सकेहाइड्रोलिसिसकोअवशोषितमुक्तफैटीएसिडऔरमोनोग्लिसराइड्समेंरोकताहै नीचेदवाइयोंकीसूचीहै,जोसमानसंरचना,ताकतऔरओबेजिटा120एमजीकैप्सूल(Obezita120MgCapsule)केविकल्पकेरूपमेंइस्तेमालकीजासकतीहै इलायचीकासेवनआपकईतरहसेकरसकतेहै।चायमेंडालकरभीइसकासेवनकियाजासकताहै।एकरिसर्चकेमुताबिकअगरइलायचीकेपाउडरकासेवनकरनेंपरपेटकीअतिरिक्तचर्बीकोकमकियाजासकताहै।आपकोबतादेंकिइसकेनियमितसेवनसेशरीरपरकोईबुराअसरनहींपड़ताहै जीहांरिसर्चसेपताचलाहैकिइलायचीकेसेवनसेवजनकमहोताहै।आयुर्वेदमेंभीइसबातकीपुष्टिकीगईहैकिइलायचीकोवजनकमकरनेंकाएकबेहतरमसालाबतायागयाहै।हरीइलायचीशरीरकेचयापचयकोबढ़ाकरआपकेपाचनतंत्रकोसाफ,शरीरकीसूजनकोकमकरनेंऔरकोलेस्टॉलकेस्तरकोकमकरतीहै।जिससेशरीरमेंअतिरिक्तचर्बीकोहटानेंमेंसहायतामिलतीहै।इलायचीमेंसिस्टोलिकऔरडायस्टोलिककोकमकरनेंकेगुणपाएजातेहै।जिससेरक्तसंचारकेस्तरकोप्रभावितकरतेहै इलायचीकोआपअपनीडेलीरुटिनलाइफमेंशामिलकरे।इसेआपकॉफीयाचायमेंडालकरपीसकतेहै।इलायचीकेदानोंकोपीसकरपाउडरबनालेऔरउसेअपनेदूधयाचाययाफिरअपनेंभोजनमेंप्रयोगकरें।इसेअलावाआपखानाखानेंकेबादभीएकइलायचीचबसकतेहै मोटापाबढ़नेंकाएकऔरकारणहैपेटमेंगैसयाशरीरमेंपानीकीकमीकाहोना।जीहांबहुतकमलोगइसबातकेवाकिफनाहोलेकिनमोटापेबढ़नेंकाएककारणयेभीहै।अगरआपकोइसतरहकीसमस्याहैतोआपबिनाकिसीदेरीसेइसकासेवनआजसेहीकरनाशुरुकरदे भारतीयरसोईमेंइलायचीउनमसालोमेंसेएकहैजिसकाइस्तेमालरसोईमेंबनेभोजनकास्वादबढ़ानेंऔरउसकीखूशबूकोदुगुनीकरनेंकेकामआताहै।अपनीतासीर,खूशबूकेकारणयहहरभारतीयरसोईकाहिस्साहोताहै।अपनीसुंगधितखूशबूकेअलावाइलायचीमेंकईऔषधीयगुणपाएजातेहै।इसेमुंहकीदुर्गन्धदूरकरनेंकेलिएभीज्यादासेवनकियाजाताहै।लेकिनबहुतकमलोगयहजानतेहैकि,इलायचीवजनघटानेंमेंभीमददगारसिध्दहोतीहै गर्मपानीपीनेकेफायदेweightlossdrinkinghotwaterbenefitsforhealthhinditipsgarampanikefaydegarampanipinekegarampaninafaydagarampanipinekenuksangarampanikebenefitsgarampaniforweightlossgarampanipinekelabhgarampaniwithhoneyhotwaterbenefitshotwaterbathhotwaterforweightlosshotwaterhoneyandlemonlifecaregharelunuskheghareluupayhomeremediesnaturalremediesbollywoodmoviesnewmovies,सिर्फपानीसेकरे20-30kgवजनकम|WeightLoss,मोटापेसेछुटकारापानीसेकमकरेवजनपानीकीसंतुलितमात्राआपकेवजनकोकमकरेपानीकैसेपियेपानीकबपियेपेटमेंजमाफेटसिर्फपानीसेबाहरनिकालियेweightlossfromwaterlossextrafatfromwaterचर्बीघटायेपानीसेचर्बीयामोटापाकमकरनेकेउपायपुरेशरीरकीचर्बीकमकरेसिर 5.

आगे की

लो बीपी का उपचार बताएं

फालिज-लकवेकाप्रकोपजिनअंगोंपरहो,उनअंगोंपरजायफलकोपानीमेंघिसकररोजलेपकरनाचाहिए।दोमाहतकऐसाकरनेसे,अंगोंमेंजानआजानेकीसंभावनादेखीगयीहै मयाध्यक्षेणप्रकृतिःसूयतेसचराचरम्।हेतुनानेनकौन्तेयजगद्विपरिवर्तते॥9.

आगे की

मानव शरीर की सबसे छोटी पेशी कौन सी है

दहीकोलेस्ट्रॉलकेलेवलकोकंट्रोलकरने,बीपीकोकमकरनेऔरवजनघटानेमेंकाफीफायदेमंदहै।घरपरबनेदहीऔरकिशमिश. 5सेकमहैं,ऐसाहोनेकेमतलबहैंकियहआपकेशरीरकोस्वस्थरखनेकेलिएआवश्यकबीएमाईसेकमहैं.

आगे की

नस रोग विशेषज्ञ पटना

पाचनतंत्रकाठीकतरहसेकार्यनाकरना 6.

आगे की

शिरा इन इंग्लिश

अबसिर्फमेरेखानेपीनेकीआदतेंहीनहींबल्किमेराशरीरभीबदलगयाहै. जीहां,आपकेवज़नकासीधातालुकआपकेमेटाबोलिज्मसेहै.

आगे की

भारत में बीपी मशीन की कीमत

कायहफार्मूलाहोताहै-वजन(कि.

आगे की

कोलेस्ट्रॉल कम करने की देसी दवा

Howtogainweightfastinhindiyouwillknow.

आगे की

देसी दवाखाना

लेकिनजबतकआपइनसभीचीजोंकोपूरेनियमकेसाथनहींकरेंगेपूरीध्यानलगाकरआपइनचीजोंकोनहींकरेंगेमोटापाकमनहींहोगा. वर्कफ्रॉमहोमकरनेवालीज़्यादातरमहिलाओंकोशिकायतहैकिइनछहमहीनोंमेंउनकावज़नछहसेदसकिलोतकबढ़गयाहै.

आगे की

कोरोना समाचार

आपछोटीप्लेटमेंखानालेंऔरखानासेपहलेएकगिलासपानीजरूरपिएं!

आगे की

जोधपुर में सर्वश्रेष्ठ दिल डॉक्टर

अपामार्गकेबीजोंकोपानीमेंपकाकरखानेसेभूखकमलगतीहैऔरचर्बीकमहोनेलगतीहै तिलकेतेलसेप्रतिदिनमालिशकरनेसेशरीरपरबनीहुईअधिकचर्बीकमहोतीहै सहजनकेपेड़केपत्तेकारस3चम्मचकीमात्रामेंप्रतिदिनसेवनकरनेसेत्वचाकाढीलापनदूरहोताहैऔरचर्बीकीअधिकताकमहोतीहै आलूकोउबालकरगर्मरेतमेंसेंकरखानेसेमोटापादूरहोताहै सरसोकेतेलसेप्रतिदिनमालिशकरनेसेमोटापानष्टहोताहै पालकके25ग्रामरसमेंगाजरका50ग्रामरसमिलाकरपीनेसेशरीरकाफैट(चर्बी)समाप्तहोतीहै।50ग्रामपालककेरसमें15ग्रामनींबूकारसमिलाकरपीनेसेमोटापासमाप्तहोताहै 1:नींबू(Lemonsemotapakamkare)(मोटापातेजीसेखत्म) बेरकेपत्तोंकोपानीमेंकाफीसमयतकउबालकरपीनेसेचर्बीनष्टहोतीहै पिप्पलीके1से2दानेदूधमेंदेरतकउबाललेंऔरदूधसेपिप्पलीनिकालकरखालेंऔरऊपरसेदूधपीलें।इससेमोटापाकमहोताहै इसउपायकेलिएआपकोएककपगर्मपानीलेलेनाहै.

आजइसलेखमेंहममोटापाकमकरनेके50आयुर्वेदिकउपायोंऔरघरेलुनुस्खोंकेबारेमेंजानेंगे आयुर्वेदिकचिकित्सककीदेखरेखमेंलिएगएअधिकतरआयुर्वेदिकउपचारसुरक्षितहोतेहैं।हालांकि,गलततरीकेयामात्रामेंलेनेपरइनकेभीकुछदुष्प्रभावहोसकतेहैं।उपरोक्तऔषधियोंऔरउपचारोंकेनिम्नहानिकारकप्रभावहोसकतेहैं: अन्यअध्ययनमेंमोटापेसेग्रस्त60प्रतिभागियोंकोशामिलकियागया।इनप्रतिभागियोंपरमेदोहरगुग्गुलनेसकारात्मकप्रभावदिखातेहुएवजनऔरमोटापेकेअन्यलक्षणोंकोकमकिया।इससेबीएमआईभीकमहुआ कास्तरघटानेकेलिएविभिन्नजड़ीबूटियोंऔरऔषधियोंकाउल्लेखकियागयाहै व्यायामकीकमी,खराबजीवनशैलीऔरखानपानकीगलतआदतोंकीवजहसेहोनेवालामोटापाएकआमस्वास्थ्यसमस्याहै।मोटापेकेइलाजकेलिएआयुर्वेदमेंशरीरऔरमनकेबीचसंतुलनलाकरखानपानकीआदतोंएवंजीवनशैलीमेंसकारात्मकबदलावलाएजातेहैं।मोटापेकीअंग्रेजीदवाओंकेकुछहानिकारकप्रभावहोसकतेहैंलेकिनआयुर्वेदिकऔषधियोंआौरजड़ीबूटियोंकाप्रयोगमोटापेकेइलाजमेंपूरीतरहसेसुरक्षितहै व्यक्तिकीप्रकृतिऔरकईकारणोंकेआधारपरचिकित्सापद्धतिनिर्धारितकीजातीहैइसलिएउचितऔषधिऔररोगकेनिदानहेतुआयुर्वेदिकचिकित्सकसेपरामर्शकरें एकचिकित्सकीयअध्ययनमेंमोटापेसेग्रस्त10प्रतिभागियोंकोलेखनबस्तीचिकित्सादीगई।इसअध्ययनकेदौरानसभीप्रतिभागियोंकीजांघ,छातीऔरबाजूएवंपेटसेफैटकमहुआ।त्रिफलाचूर्णसेउद्वर्तनऔरलेखनबस्तीकेसाथऔषधिखाना,मोटापेकोनियंत्रितकरनेमेंअसरकारीसाबितहुआहै बॉडीमासइंडेक्स)कास्तरमोटापेकासंकेतदेताहै ,मल,अग्निऔरस्त्रोतास(परिसयंचरणनाडियां)केकारणस्थौल्ययामोटापाहोताहै।आयुर्वेदिकग्रंथोंमेंस्थौल्यकोमेदोरोग(मेदधातुकारोगजिसमेंशरीरमेंमौजूदफैटशामिलहो)बतायागयाहै।इसकेकारणवसाऔरचयापचयऊतकोंमेंदिक्कतआतीहै।प्रणालीकेकार्यमेंअसंतुलनआनेपरऊतकोंमेंकुछबदलावहोतेहैंजिससेअपनेआपहीवजनबढ़नेलगताहै औरमुद्राएंजैसेकिकोबरा,मत्स्य,ऊंटऔरगायकीमुद्रामददकरतीहैं रक्त क्या है.

आगे की

फिनाले मीनिंग इन हिंदी

तबफिररातकेभोजनकेबारेमेंक्यारायहोनीचाहिए?क्याकिसीकोअंधेरेकेबादनहींखानाचाहिए?यावजनकमकरनेकेलिएडिनरछोड़देनाचाहिए,जिससेस्वस्थऔरदुबलारहाजासके. ऐसेमेंअगरअश्वगंधाकासेवनकररहेहैंतोपहलेकिसीजानकारव्यक्तिसेइसकेबारेमेंसलाहलेलेंऔरउसकेबादइसकासेवनकरें.

आगे की

छाती में दर्द होना

छातीमेंकफकीजकड़न,सर्दी,जुकामऔरसाइनसतककीपरेशानियोंमेंअजवाइनकापानीअचूकदवाकीतरहकामकरताहै. उसकेइस्तेमालसेआपत्वचाकेसंक्रमणसेमुक्तहोजाएंगे.

आगे की

डॉ रिक्कीवेग मेडिसिन सूची

रोटी(Roti)मेंप्रोटीन(Protein)औरफाइबर(Fiber)प्रचुरमात्रामेंपाएजातेहैं?

आगे की

पाकिस्तान क्या करना चाहता है

औरइसकाइस्तेमालमसालेकेतौरपरकियाजाताहै. पिछलेकुछसालोंमेंग्रीनटीकाफीलोकप्रियहोचुकीहै.

आगे की

रक्तचाप के लक्षण

बहुतसेलोगोंनेआँवलेकेरसकेरोजानासेवनसेवजनकमकरनेमेंसकारात्मकपरिणामप्राप्तकिएहैं.

आगे की

बीपी लो होने का दवा बताएं

संवादसूत्र,जीरा(फिरोजपुर):आमआदमीपार्टीकीओरसेपंजाबमेंमहंगीबिजलीकेविरोधमेंसातअप्रैलसेजनआंदोलनकियाजारहाहै।पंजाबट्रेडविगकेज्वाइंटसचिवडा. ),youneednotundergothesameprocessagainwhenyouapproachanotherintermediary.

आगे की

हृदय निक्षण अंश सामान्य सीमा

खासकरकेऔयलीस्किनवालेलोगोंमेंयेसमस्याऔरज्यादाहोतीहै.

आगे की

बीपी लो होने पर क्या नहीं खाना चाहिए

अपनेकूल्होंसेझुकेऔरअपनीअंगुलियोंकेसाथअफनेपैरोंकोस्पर्शकरें.

आगे की

हिंदी में खतरा

मैंइसकेबारेमेंलिखक्योंरहीहूं?क्योंकिमैंजानतीहूंकिबाकीमहिलाएंभीऐसाहीमहसूसकरतीहैं.

आगे की

1 2 3 4 5